KEGG   Lonchura striata domestica (Bengalese finch): 110471233Help
Entry
110471233         CDS       T05897                                 

Gene name
DOCK8
Definition
(RefSeq) dedicator of cytokinesis protein 8
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
lsr  Lonchura striata domestica (Bengalese finch)
Brite
KEGG Orthology (KO) [BR:lsr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lsr04131]
    110471233 (DOCK8)
Membrane trafficking [BR:lsr04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    110471233 (DOCK8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N GPR15L
Motif
Other DBs
NCBI-GeneID: 110471233
NCBI-ProteinID: XP_031363175
Position
Z
AA seq 2099 aa AA seqDB search
MATLPGADRRAFALKINRHSSAEIRKQFTLQPGFAQFCQRSLSTPGFSTTNLPSFYDAVD
PVDFEGFLMTQLNNLDLDLAQELGDFPEDDLDVVFTPKEFRTLQPSLPEDGVELDSHVKD
CVQTYIREWLIVNRKNQGNSDTCSLKNKGSRKDFHKTLQKQTFESETLDSGDATFQVGPQ
HVPALPEEASRPSLGCSDLELRSLQPDPRLEQLLRHVSVEEFERLNEEARRTNRHPELLA
LYPSVDEEDAVEIRPVPDCPKEHLGNRILVKLQTLKFDIEIEPLFASIALYDIKERKKIS
ENFHCDLNSDSLRGFLRSHTPSIDLSTQARSAIFSVTYPSPDIYLVIKIEKVLQQGEIGD
CAEPYMVLKESEAGKTKEKIEKLKAQAESFCQRLGKYRMPFAWIPISLSNFFNISTLERE
IQEAEGLNGKDSSSDKKATLLQARRLSERSFNSDEPASTKTLNTFFKQEGDRLSDEDLFK
FLADFKRSSSLQRRIKTLPGTLKVEISPAPENTGYCLTPELLPVKPFSENRNRPLKEILE
FPIREVYVPHTIYRNLLYVYPQRLNFANRLASARNITIKIQFMCGEDPSCAMPVIFGKSS
GPEFVQEIYTAITYHNKSPDFYEEVKIKLPAKLTEKHHLLFTFYHISCQPKQGASVETLL
GYSWLPILLNDRLQTGHYSLPVALDKLPLHYSIHSPEKIPSQTPPIKWVEGHKGVFIVDV
QAVSSVHTQDNHLEKFFTLCHSLESQVTFPFRVMDQKITEASLEHELKLSIICLNSSRLE
PLVLFLHLVLDKLFQLAVQPMVIAGQTANFSQFAFESVVAIVNSLHNSKELSKDQHGRNC
LLASYVYYVFRLPDPQREVVKPGGGSSAVSTESRYYTFGRTSAVSVGNKLLQSRVISCSN
PDITVAQAAADEEVKSVMSSKPVDHSSSRMSYYVEGTNDMSGLCASTRPSNKKHFHEELA
LQMVVSTGIVRETVFKYAWFFFELLIKSMAQYVHNTEKQDNPRRSRFSDRFKDDITTIVG
VVTSEIAALVVKPPKESEQAENINISLAFFLYDLLSLMDRGFVFKLIRHYCNQLSNKLNS
LSTLISMRLEFLRILCSHEHYLNLNFFFMTSASAPASPSPSLSSQNSSSCSSYQDQKITG
MFDLSTEYRQQHFLTGLLFTELAAALDADSEGISKVQRKAVSAILSLLSSHDLDPRCSKK
EVKIKIAALYLPLVGIILDSLPQLHDFTISDSRSGKGRTGNPEEEQESSGAINQNVALAI
AGNQFNIRNSGIPLVSLPYRQSATLGPDTTRNLLICFLWIMKNADQNLIQKWIADLPSMQ
LNRILDLLFICVSCFEYKGKQSSDKVSTQALQKSRDVKARLEEALLRGEGARGEMMKRCR
IPAGNDRSAGLNENLRWRKEQTQWRQANERQDKTKAELDQEALISGNLATEANLIILDMQ
ENIIQASFAAECRDNLLGGVLKVLVNSLGYDQSTTYLTHCFATLRALIAKFGDLLFEEEV
EQCADLCQRVLHHCSSSIDITRTQACATLYLLMRYSFSSTSNFSRVKMQVTMSLASLVGK
SPEFNEEFLRRSLRTILAYAEEDTDMQATPFPIQVEELLCNLNGILSDTVKMREFQEDPE
MLMDLMYRIAKGYQTSPDLRLTWLQNMAEKHTKRKCYTEAAMCLVHAAALVSEYLSMLED
RNYLPVGSVSFQNISSNALEESAVSDDVLSPDEDGICSGRYFSESGLVGLLEQAAELFST
XXXXETVNEVYKIVIPILEAHRDFRKLTLTHSKLQKAFDSIINKGQKRMFGTYFRVGFYG
SKFGDLDEQEFVYKEPAITKLPEISHRLEGFYGQCFGEDVVEVIKDSAPVDKRKLDPNKA
YIQITFVEPYFDEYEMKDRVTYFEKNFNICRFMYTTPFTMDGRPRGELYEQYKRNTILTT
MHAFPYIKTRINVIQREEFILTPIEVAIEDMRKKTQELTAATNQEPPDAKMLQMVLQGSV
GATVNQGPLEVAQVFLDEIPADPKLYRHHNKLRLCFKEFIMRCGEAVEKNKQLITADQRE
YHQELRRNYMKLKENLRPMIERKIPELYKPVPLKILSIRESFRNHSFRKYDAQTSSQST
NT seq 6300 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgttacctggcgcagacaggagggcgttcgccctgaaaatcaacaggcactcg
tctgcagaaataagaaagcagtttactctccaaccaggctttgcacagttctgtcaacga
agcttaagtacccctggcttttctacaactaatctgccttccttttatgatgcagtagac
ccagtagattttgaaggcttcctgatgacacagctgaataacttggacttagatctagca
caagaacttggggactttcctgaagatgatctggatgttgtctttacacccaaagagttc
aggactttgcaaccctctttgccagaagatggggttgaactggactcacatgtcaaagac
tgtgttcagacttacatccgtgagtggctgattgtgaatcgaaaaaaccaagggaattca
gatacttgtagcctgaaaaacaagggatcccgaaaagattttcacaaaacgcttcaaaaa
caaacatttgaatcagaaacattggattctggcgatgcaacttttcaggttggaccccag
cacgtgcccgctctcccggaggaggcttccaggccgagcctgggctgctcggacctggag
ctgcgcagcctgcagccggacccgcggctggagcagctgctgcggcatgtcagtgtggag
gagtttgagaggctgaacgaggaggcacgccgcaccaacaggcaccccgagctcctcgcc
ctctacccctccgtggatgaggaagatgcagtggagatacggccagtgccagattgccca
aaggaacatctgggcaacaggattttggtgaagctgcagactctgaagtttgatatagag
atagaacctttgtttgcaagtatagctctctatgacataaaggaaagaaaaaagatctcg
gaaaattttcattgtgacctcaattctgattctttaagaggattcttgcgttctcataca
ccctccattgacttgtctactcaggcaagatcagcaatattttctgtcacttatccctca
ccagacatatacctggtaataaagatagaaaaagtgcttcagcaaggagaaattggagac
tgcgcagagccctacatggttcttaaagaaagtgaggctggcaagacaaaagaaaagatt
gaaaaactgaaagcacaagcagaatccttttgtcagaggttagggaaatacagaatgcca
tttgcctggattcccataagcctgagtaatttcttcaacatttcaacacttgaacgagaa
atacaagaagctgaaggtttaaacgggaaagattccagtagtgacaagaaggcaacactg
ctacaggcaagaaggctttctgagagaagtttcaactcagatgaaccagcatcaaccaaa
acccttaacaccttctttaaacaggaaggagacaggctcagtgatgaagatctatttaaa
tttttagctgatttcaaaagatcatcttccttgcaaagaagaattaagactttaccagga
acacttaaagtagagatttccccagctccagaaaacactggttattgtctgacaccagaa
ctactcccagtgaagccattttcagaaaaccgtaatcgccctctcaaagagattttggaa
ttcccaattagagaagtgtatgttccccacaccatttatagaaatctcctctatgtttac
cctcagaggctgaattttgctaacagactggcttctgcaaggaatattaccatcaagatc
caatttatgtgtggtgaagacccatcctgtgcaatgccggtaatttttgggaaatcttca
ggtccagaatttgtccaagaaatatacacggctatcacatatcataataaatctcctgac
ttttatgaagaagtcaaaattaagctgccagcaaaactcacagagaagcaccatctactg
ttcacattctaccacatcagctgccaaccaaagcaaggagcatctgttgaaaccctccta
gggtattcatggctgccaattctattaaatgatcgtcttcaaactggacattatagtctt
cctgttgcattggataaactgcctttacactactcaattcactctcctgagaaaattcca
tctcagacaccccctataaagtgggttgaaggacacaagggcgttttcattgttgacgtt
caagctgtgtcatctgttcacacccaggataaccatctggagaagttcttcactttgtgc
cattctctggaaagccaagtgacattcccctttcgagtgatggatcagaagattacagag
gcttcactggagcatgaattgaaactcagcattatctgtttgaattcttcacgccttgaa
cctcttgtcctatttttgcatttggtactagataaacttttccagctggctgtacaacct
atggtcatagctggccagacagccaacttctcacagtttgcctttgagtcagtggttgca
atagtgaatagtctccacaacagcaaagagctgagcaaggaccagcatggaaggaactgt
ctcctggcatcttatgtgtactatgtatttcgtctgccagacccacaaagagaagtggtc
aaaccaggtggaggcagcagtgctgtttcgacagaatctcgttattacacctttggacgc
acgtctgcagtgtctgttggaaataaactcctgcagagcagagtgataagctgcagcaat
cctgacatcactgttgcacaagctgctgctgatgaggaggtcaaaagcgtcatgtcatcc
aagcctgtggatcacagctccagtcgtatgtcttactacgttgaaggaacaaatgatatg
tcaggcctttgtgcaagcacaagaccctccaataaaaagcatttccatgaggagctggca
ttgcagatggtggtcagcacgggcatagtgagagaaacagtcttcaagtatgcctggttc
ttctttgagctcctgataaagagtatggctcagtatgttcacaacacagagaagcaagat
aacccaagaagaagccggttctccgatcgttttaaagatgatattaccactatagttggt
gtggttacttcagagattgctgcacttgtagtcaaaccacccaaggaaagtgaacaagca
gaaaatattaatatcagcctggcatttttcttgtatgatcttctttctttgatggataga
ggatttgtgtttaagctcatcagacattactgtaatcagctttcaaacaagctgaattca
ctctccaccctgatttccatgagacttgagttcctgagaattctctgcagccatgagcat
tacctcaatctgaacttcttcttcatgacatctgcatctgctccagcatctccctctccc
tccttgtcctcccagaactccagctcctgctctagttaccaggaccagaaaatcactggt
atgtttgacctctcaactgaataccgtcagcagcacttcctgactggcttacttttcact
gaactggcagcagcattggatgcagacagtgaggggattagcaaggtgcaaagaaaagct
gtcagtgctatccttagcctgctgagttcccatgacctagacccacgttgctccaaaaag
gaggtgaagattaaaattgcagctctttacctccctttggttggtattattttggattca
ctaccacaactccatgattttacaatttcagatagccgcagcggaaagggacgcacagga
aacccagaagaagaacaagagtcttcaggtgcaatcaaccaaaatgtggcccttgccatt
gcagggaatcagttcaacatcaggaactctggaatacctctggtatccctgccctacaga
cagagtgccacattaggtcctgatactactcgcaaccttttgatctgttttctctggatt
atgaaaaatgctgatcagaacctaatacagaaatggattgcagaccttccatccatgcag
ctgaacaggattttagacctcctcttcatttgtgtttcatgctttgagtataagggcaag
caaagctcagataaagtcagcacccaagcactccagaagtcacgcgatgtgaaagctcga
ttagaagaggctttactgagaggagaaggagccagaggagaaatgatgaagcgctgcaga
ataccagctgggaatgacagatcagcagggctaaatgaaaatttgcgctggagaaaggag
cagacgcagtggcggcaggcaaatgagagacaagataagacgaaagctgagctagaccaa
gaagctctgatcagcggaaacctggcaactgaagctaacctgatcattcttgatatgcaa
gagaacatcattcaggcaagctttgcagcagaatgcagagataatctcctgggaggagtt
ttgaaggtcctggtaaattctcttggctatgatcagagcacgacttacctgactcattgc
tttgccacactcagagcactcattgccaagtttggagatttgctgtttgaagaagaggtt
gaacagtgtgctgacctgtgtcaaagagttctccatcactgcagcagcagcatagacatt
acacggactcaagcctgtgccactctttatctcctcatgagatacagcttcagctctacc
agtaatttttcaagagtgaagatgcaggtgaccatgtcactagcttctctggttggaaaa
tctcctgagtttaatgaggaattccttcgacgatccttgagaaccatcctggcctatgca
gaggaagatacagatatgcaggcaacaccatttcccattcaggtagaggagctactgtgt
aatctgaatggcatcctgtcagatacagtgaaaatgagggaatttcaggaagatccagag
atgctgatggacctcatgtacagaattgcaaaaggataccagacatcgccagacctgagg
ctgacttggctgcagaacatggcagagaagcacaccaagaggaagtgctacacagaagca
gctatgtgcctggtccatgctgcagcactggtctcagaatacctgagcatgcttgaggat
cgcaactatctccctgtgggcagcgtcagttttcagaacatttcatccaatgcgctggag
gaatctgctgtttcagatgatgttttgtctccagatgaagatggcatatgttctgggagg
tatttctcagaaagtggactggtaggcctgctggaacaagctgcagagctcttcagcacn
nnnnnnnnnnatgaaactgtgaatgaagtgtacaaaattgtcatccccatactggaagca
catcgagacttcaggaagcttaccttgacacacagcaagctacagaaggcctttgacagc
attattaataagggtcagaaacgaatgtttggaacttacttccgtgttggtttctatgga
tcaaaatttggggacttagatgaacaggaatttgtttataaagagcctgcaattacaaaa
ctcccagagatttctcacagattagagggattttatggccagtgttttggggaggatgtt
gtggaagtgattaaggactctgctcctgtagacaaaagaaagctggatcccaataaggca
tacatacaaattacttttgtggagccctattttgatgagtatgagatgaaggacagagtt
acctatttcgaaaagaacttcaacatctgtcggttcatgtacactacgcctttcactatg
gatgggcgtcccagaggagaactttatgagcaatacaagaggaacaccatcctaaccaca
atgcatgctttcccctacatcaaaactagaatcaatgtcatccaaagagaagagtttatt
ttaacaccaattgaagttgctattgaagatatgcgtaaaaaaacacaggaactaactgca
gccaccaaccaagaaccaccagatgccaaaatgctccagatggttttgcagggctcagtt
ggagccactgtaaatcagggaccactagaggtagcacaagtgttcctggatgaaattcca
gcagaccccaaactttatcgacatcacaacaagctgaggttgtgcttcaaagagtttata
atgaggtgtggtgaagcagtggagaaaaacaagcaacttattactgctgatcagcgggaa
tatcatcaggagctcagaagaaactacatgaaactgaaggagaaccttaggcccatgatt
gagaggaagatcccagagctgtacaaacctgtaccgcttaagatccttagcataagggaa
tcttttcgtaaccacagttttaggaaatatgatgcccagacttcttcccaaagcacctaa

DBGET integrated database retrieval system