KEGG   Lonchura striata domestica (Bengalese finch): 110472158Help
Entry
110472158         CDS       T05897                                 

Definition
(RefSeq) cytosolic phospholipase A2 epsilon-like
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
lsr  Lonchura striata domestica (Bengalese finch)
Pathway
lsr00564  Glycerophospholipid metabolism
lsr00565  Ether lipid metabolism
lsr00590  Arachidonic acid metabolism
lsr00591  Linoleic acid metabolism
lsr00592  alpha-Linolenic acid metabolism
lsr01100  Metabolic pathways
lsr04010  MAPK signaling pathway
lsr04217  Necroptosis
lsr04270  Vascular smooth muscle contraction
lsr04370  VEGF signaling pathway
lsr04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:lsr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    110472158
   00565 Ether lipid metabolism
    110472158
   00590 Arachidonic acid metabolism
    110472158
   00591 Linoleic acid metabolism
    110472158
   00592 alpha-Linolenic acid metabolism
    110472158
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110472158
   04370 VEGF signaling pathway
    110472158
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110472158
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    110472158
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    110472158
Enzymes [BR:lsr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     110472158
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B cPLA2_C2 C2
Motif
Other DBs
NCBI-GeneID: 110472158
NCBI-ProteinID: XP_021389285
Position
Unknown
AA seq 809 aa AA seqDB search
MANQICLDSRQRVTDCELDMAPVSPFNLLTVKILRVRNARKADLLTLSDCYVTLWLPTAS
AEKVRTRTIRNSKNPVWNEAFCYKIDRRVKNVLELKVCDEDTVTRDDELCTVLFDIDKLT
VGRTVRVKFQLNPQAREELEVEFTLQNTLDFPDGIITNGVLVAREVSCLEVRVDTGKMKQ
QSTNPELTFTVKGSHEGSQKILLASGPSLHIIIFHCIINDQTRLDVLLPEELAGGNETEK
SGVLSFPLNSLPLQKEIILEECALIYLIVCSSSGDLDVRLGFSLCTEEQNFLRKRKKYVA
AALKKILNLEEDLKEHEVPVVAITTTGGGTRSLTAMYGSLLGLQKLNLLDCISYIGGLSG
TTWTMANLYEDANWSQKYLEDAIKEARKQVTKSKICCFSLDCLKYYYNDLMERTKEGHNT
SFIDLWGLVIESMLHDKKDEHRLSDQRQAVDNGQNPLPIYVAINLKSNYSAQAFREWLEF
TPYEVGLLKYGASIRAEHFGSQFFMGRMVKKLSETRICYMQGMWSSIFSIDAMYVWNLAA
DSEDFWCRWTRDRVKDIAEEPFLSVNPYEVDTCLFTPSSVFSSTLRDVLTGRPTIAQYPN
FIRGFQLHNKYLESEGFSTWKDTVIDSLPNKLMETADNELSLVDTGFFINTSYPPLLRSK
REVDVILHLNYSGGSQTLPLDQIAKYFSEQEIPFPKIEISEEDRENLKECYVFEDADSPQ
APTVLFFPLVNDTFKKYKAPGVERSPEEMAEGKVDVSSILSPFTTREVCFSEENFDKLVK
LTDYNVLNNEKLIIQALRLAVARRKQRNY
NT seq 2430 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatcagatctgcctggactctcgacagagggtcacggattgtgagttagatatg
gcaccagtatctcccttcaacttgctcactgtaaaaatactaagagtgaggaatgcccgg
aaggcagacttgctcaccctttcagattgctatgtgacactgtggctgcctactgcctca
gcggagaaggttcggaccaggaccatcaggaacagcaaaaaccccgtttggaacgaagcg
ttctgctacaagattgaccgccgtgtcaagaacgtgctggagctgaaggtctgtgatgaa
gacacggtcaccagggatgatgaactctgcacagttctcttcgacatagataagctcact
gtgggacgtactgtccgtgtgaagtttcagctgaatccacaggcacgggaggagctggag
gtggagttcacattgcagaacactctggactttcctgatggcattattacaaatggagta
ctagtggcacgtgaggtttcctgtttggaggttagagtggatacagggaagatgaagcag
caatccacaaacccagagcttacatttacagtgaaaggatcacatgaaggaagccagaag
attttgctggcatctggccccagccttcatataattatatttcactgcatcataaatgac
cagacaaggctggatgtcctattaccagaagagttggctggtggaaatgaaacagagaaa
tctggggtcctttctttccccctgaattcactccctttgcagaaagaaataatactagaa
gagtgtgcattgatttatctcattgtctgttccagctcaggagacctggatgtgcgcctg
gggtttagcctgtgcacggaggagcagaacttcctgcggaaaaggaaaaaatatgttgct
gctgctctgaaaaagattcttaatttggaagaggatctgaaagagcatgaggtgccagtg
gtggccattacgacaacggggggaggaacgagatcgctcacagcaatgtacggcagcctg
ctgggcctccagaaactcaacctcttagactgcatttcctacatcgggggtttatcgggt
accacatggaccatggcaaacttatatgaagatgctaattggtcacaaaaatatctagag
gatgcaatcaaggaagctcgcaagcaagtaaccaaatccaagatctgctgtttttctttg
gattgtctgaagtactattacaatgacctgatggagaggactaaagaaggacataacact
tctttcatagacctttggggacttgtcattgaatccatgctacacgataagaaagatgag
catagactctcggaccagcgtcaggcagtggataatggccagaatccactgcccatctat
gtggccatcaacctcaagtccaactatagtgcccaggcattcagagagtggctggagttc
actccttatgaagttggtctgctgaaatatggagcatctattcgcgcagaacactttgga
agtcaattctttatgggaaggatggtgaagaagctctcagagactcggatctgctatatg
caaggcatgtggagtagtatattttccatagatgcaatgtatgtctggaatttggctgct
gattcagaagatttctggtgcagatggaccagagacagagtaaaagatatagcagaagaa
ccctttctgtctgtgaatccctatgaagtagacacgtgtctattcactccctcaagtgtc
ttctcctccactctgcgagatgtcttaacaggacgtccaaccattgcacagtatcccaat
ttcatcagaggcttccagctgcataacaagtacctggagagtgaaggattttctacctgg
aaagacacagtaatagactcccttccaaataaactgatggaaacagcagacaatgagctc
tccctggttgatactggctttttcattaataccagctacccaccacttttgagatcgaaa
agggaagtcgatgtcatcctccatttgaattacagtggagggtcccaaacactgcctctg
gatcagattgcaaagtacttctcagagcaagaaattccatttcccaaaattgagataagt
gaggaagacagggaaaacttgaaggagtgctatgtgtttgaagatgctgacagtccacaa
gctccaacagtgcttttctttcccctagtaaatgacaccttcaagaaatataaagctcct
ggtgtggaaaggagtcctgaagagatggctgaaggcaaagttgatgtctccagcatcctc
tctccatttacaacaagagaggtgtgtttcagtgaagagaattttgacaaactggtgaaa
ctgacggattacaatgtcctgaacaatgagaagttgattattcaggccttgcgcttggca
gtggcacggaggaagcagcggaattattaa

DBGET integrated database retrieval system