KEGG   Lonchura striata domestica (Bengalese finch): 110472409Help
Entry
110472409         CDS       T05897                                 

Gene name
DCXR
Definition
(RefSeq) L-xylulose reductase
  KO
K03331  L-xylulose reductase [EC:1.1.1.10]
Organism
lsr  Lonchura striata domestica (Bengalese finch)
Pathway
lsr00040  Pentose and glucuronate interconversions
lsr01100  Metabolic pathways
Module
lsr_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:lsr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    110472409 (DCXR)
Enzymes [BR:lsr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.10  L-xylulose reductase
     110472409 (DCXR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short KR Shikimate_DH NAD_binding_10 THF_DHG_CYH_C RmlD_sub_bind Epimerase ApbA NmrA Sacchrp_dh_NADP DUF1776 Glyco_trans_4_4
Motif
Other DBs
NCBI-GeneID: 110472409
NCBI-ProteinID: XP_021389743
Position
Unknown
AA seq 246 aa AA seqDB search
MEPHLSFGGRRALVTGAGKGIGRSVAVALSRAGARVTALSRTAADLESLARECPGIETLC
VDLADWEAAEAAVGAAGPFQLLVNNAAVAELQPFLEVTRSALQRSLDVNFGAVLHVSQIV
ARQMIAQGVPGAIVNVSSQASKRALRDHAVYCSTKSALDMLSKVMAMELGPHKIRVNTVN
PTVVMTDMGRINWSDPQKSAAMINRIPLGKFAEVDDVVNSILFLLSDKSAMTTGSSLMVD
GGFLVS
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atggagccgcatctcagcttcggcggccggcgggccctggtgactggggctggcaaaggg
atcggtcgctccgtggccgtggcgctgagcagggccggggctcgcgtgactgcgctgagc
cgaacggcggcggacttggagagcctcgcgcgggagtgcccgggcatcgagaccctctgc
gtggacctggcggactgggaggctgcggaggcggcggtgggcgcggcggggccgttccag
ctgctggttaacaacgcagcggtggcggagctgcagccgttcctggaggtgacgcgctcg
gccctgcagcggtctcttgatgtgaattttggggctgtgcttcatgtttcccagatagtt
gctcggcagatgattgcacagggggtgccaggagctattgtgaatgtctccagccaggca
tcaaagcgtgcgctgagggatcatgctgtctattgttccacaaaaagtgctctggatatg
ctgagcaaagtaatggcaatggaactgggaccccacaagattagggtgaacactgtgaac
cccaccgtggttatgactgacatggggagaattaactggagtgaccctcagaaatctgct
gccatgattaatcggattccgctgggaaagtttgcagaggtggatgatgtggtgaacagc
attctcttcctgctgagtgacaagagtgctatgacaactggcagctcactgatggttgat
gggggctttcttgtctcctaa

DBGET integrated database retrieval system