KEGG   Lonchura striata domestica (Bengalese finch): 110472466Help
Entry
110472466         CDS       T05897                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: probable low-specificity L-threonine aldolase 1
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
lsr  Lonchura striata domestica (Bengalese finch)
Pathway
lsr00260  Glycine, serine and threonine metabolism
lsr01100  Metabolic pathways
lsr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lsr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    110472466
Enzymes [BR:lsr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     110472466
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 110472466
NCBI-ProteinID: XP_021389858
Position
Unknown
AA seq 418 aa AA seqDB search
MRDPAPAREPLRGAVPAMRVVLRRGRLPGPGRMTGETEPRGSAAALPFVVDLRSDTVTRP
CAVMRXMALATVGDDDYGEDPAVNGLPRRAAGTVGSESALFVPTATVMNLIAAMCHCQRS
GAQPSLGQDAHLHLYEHGGGRGGGYDGRRAAAHGLQHEWGLYTPDKRGQRAGAPVHHDCP
LPALCSPLPWAQVAGVHSQSLPDLPNGTFDQDQLELTLCEAHSSRYHTRPELICLENMHN
SWGGRALFLTCLRQVCGLADHYRLWVHMDGAXLMNAAVAQGVEPAQIAQHCDSVPXCFSK
GMGALAGAVLAGCREFVAKAWRVRKLLGRGMGALAAAAHLRLQQVKVTLHRDHNNAWNFA
EGTSGPLSVLGCNNTPGTAQQCCCSGGLDTIPGWPHWVSSWVRMLLGSSPGWSARIMP
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgatcccgcccccgcccgggagcccttgcggggggcggtcccggccatgcgggtg
gtgctgcggcgggggcggctgcccgggccggggaggatgaccggggagacggagccgcgg
ggttccgccgcggccctgccgtttgtcgtggacctgcggagcgacacggtgacccggccg
tgcgcggtgatgcgcnncatggccctcgccaccgtgggcgatgacgactacggggaggac
ccggcggtgaacgggctgcctcgccgggccgcggggactgtggggtcggaatcggctctg
ttcgtgcccacggccaccgtgatgaacctcatcgccgcgatgtgccactgccagcgcagc
ggggctcagccgtccctgggccaggacgcccacctgcacctctacgagcacggcgggggc
cgtggcggtggttacgatggcaggagggcggctgcacacgggctgcagcacgagtggggg
ctgtacacacctgacaagaggggacagagggctggagcccccgtgcaccacgactgtccc
ctgccagctctgtgctctcccctgccctgggcacaggtcgccggtgtgcactcccagtca
ctgccagatctgccaaatggcacgtttgaccaggatcagctggagctgactctctgtgag
gcccacagcagccggtaccacacgcgtcctgagctcatctgtctggagaacatgcacaac
tcgtgggggggccgggcactgttcctcacctgtctcaggcaggtctgtgggcttgcagac
cattacaggctgtgggtgcacatggatggcgcatgactgatgaatgcagcagtggcccag
ggtgtggagccagctcagattgcccagcactgtgactctgtcccgnnctgcttctccaag
ggcatgggcgccctggctggtgcggtgttggcagggtgcagggagtttgtcgccaaagcc
tggcgtgttcggaagctgctgggcaggggcatgggagcgctggcagctgctgcccacctc
aggctgcagcaggtgaaggtgacgctgcacagagaccacaacaatgcctggaactttgca
gaaggtacctcgggtcccctgagtgtgctgggatgtaacaacacacctggcactgcccag
cagtgctgctgtagtggtggcttggacaccatccctggatggccacactgggtctccagc
tgggtgaggatgctgctgggatcctcacctggctggagtgccaggatcatgccatga

DBGET integrated database retrieval system