KEGG   Lonchura striata domestica (Bengalese finch): 110472561Help
Entry
110472561         CDS       T05897                                 

Gene name
PLK2
Definition
(RefSeq) serine/threonine-protein kinase PLK2
  KO
K08861  polo-like kinase 2 [EC:2.7.11.21]
Organism
lsr  Lonchura striata domestica (Bengalese finch)
Pathway
lsr04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:lsr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    110472561 (PLK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lsr01001]
    110472561 (PLK2)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lsr03036]
    110472561 (PLK2)
Enzymes [BR:lsr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     110472561 (PLK2)
Protein kinases [BR:lsr01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   110472561 (PLK2)
Chromosome and associated proteins [BR:lsr03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    110472561 (PLK2)
   Centrosome duplication proteins
    Regulators of centriole replication
     110472561 (PLK2)
  Sister chromatid separation proteins
   Polo kinases
    110472561 (PLK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr POLO_box Pkinase_fungal Kinase-like
Motif
Other DBs
NCBI-GeneID: 110472561
NCBI-ProteinID: XP_021390011
Position
Unknown
AA seq 664 aa AA seqDB search
MELLRTIAHPPGGGGAKGCEAAAGRAAGGESRRKKAEEPPHQHGHPAAEVSRIITDPTTG
KRYCRGKVLGKGGFAKCYEMTDLTTNKVYAAKIIPHSRVAKPHQREKIDKEIELHRMLNH
RHVVQFYHYFEDRENIYILLEYCSRRSMAHILKARKVLTEPEVRYYLRQIVSGLKYLHEQ
EILHRDLKLGNFFINENMELKLGDFGLAARLEPLEHRRRTICGTPNYLSPEVLNKQGHGC
ESDIWALGCVMYTMLLGRPPFETTNLKETYRCIREARYSLPSSLLAPAKHLIASMLSKNP
EDRPSLDEIIRHEFFLQGFTPERLSASCCHTVPDFHLSSPAKNFFKKAAAALFGGKKDKA
RYLDTHNRLAKEDEEIYKLRHDLKKTSITQQAPKHKTDEEIQPLITTVVKPGALPETKQI
GDSIRMIVRGTLGSCSSSSECLEDSTMGSVADTVARVLRGCLENMPEADSNPKEQLTASF
QWVTKWVDYSNKYGFGYQLSDHTVGVLFNNGAHMSLLPDKKTVHYYAELGQCSVFSATEA
PEQFINQVTVLKYFSHYMEENLMDGGDLPSLTDVRRPRLYLLQWLKSDKALMMLFNDGTF
QVNFYHDHTKVIICNQSEEYLLTYINEDRISTTFRLTTLLVSGCSLELKYRMEYALNMLL
QRCN
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atggagctcctacggactatcgcccacccgccgggcggcggcggtgccaagggctgcgag
gcggcggcgggcagagcggccggcggcgagtcacgcaggaagaaggcggaggagccgccg
caccagcacggccaccccgcagccgaggtctcccggattattaccgaccccacgacgggg
aagcgttactgccgcggcaaggtgctcggaaagggtggatttgccaagtgttacgagatg
acagacttgacaacaaataaagtttatgctgcgaaaatcattcctcacagcagagtagca
aaacctcatcaaagggagaagattgataaagagattgagctgcacagaatgcttaatcac
agacatgttgtgcagttttaccactactttgaagatagagagaatatttacattcttctg
gaatactgcagcagaaggtcaatggctcacatcttaaaagcgaggaaggtattaacagaa
ccagaagtacgatactacctcaggcaaattgtgtcagggctaaagtatcttcatgaacag
gaaatcttacacagggatcttaaactaggtaacttctttatcaatgagaacatggaactg
aagcttggtgactttggcttggcagctaggctggaaccactggaacacagaaggagaaca
atatgtggcacaccaaattacctctctccagaagtcctcaacaaacaagggcatggctgt
gaatctgatatatgggccttaggctgtgtaatgtatacaatgctgttgggaagaccccca
tttgagactacaaatcttaaagaaacatacagatgtataagggaagcaagatacagtctg
ccttcatctctcttggcacctgcaaaacacttaatagctagcatgttgtcaaaaaaccct
gaggatcggcccagtttagatgaaataattcgacatgaattcttcttacagggttttaca
cctgagagactttctgcaagctgttgtcacaccgtccctgatttccatttgtcaagtcct
gctaaaaatttcttcaaaaaagcagctgctgctctctttgggggaaaaaaggataaggcc
agatatttggacacacataacaggctagctaaagaagatgaagaaatctacaagctcaga
catgatttgaagaagacgtcgataacccagcaggcccccaaacacaagacagatgaggag
attcagcctcttatcacaacagtggtgaagcctggagctttgccagaaactaagcagatt
ggagactccattcggatgatagtcagaggaactttgggaagctgtagcagtagcagtgaa
tgtttggaagacagtactatgggaagtgttgccgatacagttgcaagagtcttgagggga
tgtctggagaatatgccagaagcagacagcaatcccaaagaacagctgacagcatccttc
cagtgggttacaaagtgggtggactactccaacaagtatggctttgggtaccagctgtca
gatcacactgttggtgtcctcttcaacaatggggcacatatgagccttctgccagacaaa
aagacagtgcattactatgctgagctaggccagtgctctgtcttctcagccacagaagcc
cctgaacagttcattaaccaagtaactgtgctgaagtatttctctcactatatggaggag
aaccttatggatggaggagacttgcccagcctaacagacgtacgcaggcccaggctttac
ctcttacagtggctcaaatctgataaagcattaatgatgctcttcaatgatggcactttt
caagtgaacttctaccatgatcacacaaaagtcataatttgcaatcagagtgaggaatat
ctccttacctacataaatgaagacaggatatccacaacgtttcgtctgacaactcttctg
gtttcgggatgttcattggaactaaaatacagaatggaatatgctctgaacatgctgctg
cagcgatgtaactga

DBGET integrated database retrieval system