KEGG   Lonchura striata domestica (Bengalese finch): 110473337Help
Entry
110473337         CDS       T05897                                 

Gene name
CDK1
Definition
(RefSeq) cyclin-dependent kinase 1
  KO
K02087  cyclin-dependent kinase 1 [EC:2.7.11.22 2.7.11.23]
Organism
lsr  Lonchura striata domestica (Bengalese finch)
Pathway
lsr04110  Cell cycle
lsr04114  Oocyte meiosis
lsr04115  p53 signaling pathway
lsr04218  Cellular senescence
lsr04540  Gap junction
lsr04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:lsr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110473337 (CDK1)
   04114 Oocyte meiosis
    110473337 (CDK1)
   04115 p53 signaling pathway
    110473337 (CDK1)
   04218 Cellular senescence
    110473337 (CDK1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    110473337 (CDK1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    110473337 (CDK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lsr01001]
    110473337 (CDK1)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:lsr03032]
    110473337 (CDK1)
   03036 Chromosome and associated proteins [BR:lsr03036]
    110473337 (CDK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lsr04147]
    110473337 (CDK1)
Enzymes [BR:lsr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     110473337 (CDK1)
    2.7.11.23  [RNA-polymerase]-subunit kinase
     110473337 (CDK1)
Protein kinases [BR:lsr01001]
 Serine/threonine kinases: CMGC group
  CDK family
   110473337 (CDK1)
DNA replication proteins [BR:lsr03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    110473337 (CDK1)
Chromosome and associated proteins [BR:lsr03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    110473337 (CDK1)
Exosome [BR:lsr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110473337 (CDK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase APH Kinase-like Seadorna_VP7 Kdo Choline_kinase
Motif
Other DBs
NCBI-GeneID: 110473337
NCBI-ProteinID: XP_021391470
Position
Unknown
AA seq 302 aa AA seqDB search
MDDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELNH
PNIVCLQDVLMQDSRLYLVFEFLSMDLKKYLDSIPSGQYLERSRVKSYLYQILQGIVFCH
SRRVLHRDLKPQNLLIDDKGVIKLADFGLARAFGIPVRVYTHEVVTLWYRSPEVLLGSAR
YSTPVDIWSIGTIFAELATKKPLFHGDSEIDQIFRIFRALGTPNNEVWPEVESLQDYKNT
FPKWKPVSLETHVKNLDKDGLDLLAKMLIYDPAKRISGKMALNHPYFDDLDKSTLPANLI
KK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggatgattacacaaaaatagagaagattggggaaggtacctatggtgttgtgtataaa
ggtcgtcacaaaaccacaggccaagtggttgcaatgaagaaaatacgtctagaaagtgag
gaggaaggtgttccaagtactgctatccgagaaatttctttattaaaagagctgaatcat
cccaatatagtctgtcttcaggatgttctcatgcaggattcaagactgtacctcgtcttt
gaattcctttccatggatctcaagaaatatttggatagtattccatctggccagtatttg
gagcgttcccgagttaagagctatctgtaccaaattttgcaaggtattgtcttctgccac
tcaagaagagttctgcacagagacttgaaacctcagaacctcctgatagatgacaaggga
gtgattaaactggcggattttggactggctcgagcctttggaattccagtgcgggtctac
acgcatgaagtagtaacactgtggtacaggtctccagaagtactgctgggatctgctcgt
tactctactcctgtagatatctggagcataggaaccatatttgctgagctggcaactaaa
aagccacttttccatggggattcagagattgaccagatcttcagaatcttcagagcttta
gggactcccaacaacgaggtatggcctgaggtggaatccctgcaagactataaaaacaca
ttcccaaaatggaaacctgtcagcctcgaaacacatgtcaaaaacttggacaaagatgga
cttgatctgctggctaaaatgttaatttatgatcctgcaaaaaggatttctggaaaaatg
gccttgaaccatccatattttgatgatttggacaaatccactcttcctgctaatctgata
aagaaatag

DBGET integrated database retrieval system