KEGG   Lonchura striata domestica (Bengalese finch): 110474811Help
Entry
110474811         CDS       T05897                                 

Gene name
SLC4A1
Definition
(RefSeq) band 3 anion transport protein
  KO
K06573  solute carrier family 4 (anion exchanger), member 1
Organism
lsr  Lonchura striata domestica (Bengalese finch)
Brite
KEGG Orthology (KO) [BR:lsr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lsr02000]
    110474811 (SLC4A1)
   04147 Exosome [BR:lsr04147]
    110474811 (SLC4A1)
   04090 CD molecules [BR:lsr04090]
    110474811 (SLC4A1)
Transporters [BR:lsr02000]
 Solute carrier family (SLC)
  SLC4: Bicarbonate transporter
   110474811 (SLC4A1)
Exosome [BR:lsr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110474811 (SLC4A1)
CD molecules [BR:lsr04090]
 Proteins
  110474811 (SLC4A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HCO3_cotransp Band_3_cyto
Motif
Other DBs
NCBI-GeneID: 110474811
NCBI-ProteinID: XP_021394174
Position
Unknown
AA seq 827 aa AA seqDB search
MEGPGQEAYEEGMRRTLDPEGYEDPGLKSSHLSLGEMSTVSVTDVELEAAGSRRLLSQQD
THEGYVELHELVLDNAKDLCWMEAGHWLKLEEDFQESGDWSQPHLSFLTYHSLLEIRRAL
NKGAVLLNVEANSLPAIVHILLDQLIYEGQVKPQDRDDVMRTLLLRHSHPTEDESVWTMP
PALVQRSGTTRADVERPLLREQRPLEMSRMAGKEQVSGDRWHGGHWGQWGAGDAPGHTHT
LAHPLLRALVPLQRELLRRRYQPLERLHIGGFLKDLGPEEAAAAEDDDPLRRTGRPFGGL
VRDIRRRYPKYLSDIKDALNPQCLAAVIFIYFAALSPAITFGGLLGEKTKGMMGVSELLI
STCVQCVLFSLLSAQPLLVVGFSGPLLVFEEAFYSFCSSNGLEYIVGRVWIGFWLILLVL
VVVACEGSFLVRYLSRYTQEIFSFLISLIFIFETFSKLVTIFKHHPLQREYNVQAEFQPG
VPEPNTALLSLVLMAGTFFMAFFLRVFKNSSFLPGKVRRLIGDFGVPISIFIMALADFFI
NDTYTQKLSVPRGLQVTNATARGWFIHPMGNNAPFPIWMMFASVIPALLVFILIFLETQI
TTLIVSKPERKLVKGTGFHLDLLLIVAMGGLAALFGMPWLSATTVRTITHANALTIMSKT
SAPGEKSQILEVKEQRISGLLVAVLIGVSILMEPILKYIPLAVLFGIFLYMGVTSLFGIQ
LFDRILLLLKPPKYHPDEPYVTRVKTWRMHLFTFTQIIFLVVLWVVKSTPASLALPFVLI
LTVPLRRFLLPRIFRDIELKCLDADDAVVTFEEAEGTDVYNEVQMPS
NT seq 2484 nt NT seq  +upstreamnt  +downstreamnt
atggaggggcccggccaggaggcctacgaggaggggatgaggaggaccctggaccccgaa
ggctacgaggaccccggcctaaagagctcccacctgtccctgggcgagatgagcactgtg
tcagtgaccgatgtggaactggaggcagcgggcagcaggaggctcctgtcccagcaggac
acccatgagggatatgtggagctgcacgagctggtcctggacaatgcaaaggacttgtgc
tggatggaggccggccactggctcaagctggaggaggacttccaggagtcgggggactgg
agccagccccatctctccttcctgacctaccacagcctcctggagatccgccgggctttg
aacaaaggtgccgtcctgctcaacgtggaggccaactcgctgccggccatcgtgcacatc
ctcctggaccagctgatctacgaggggcaggtgaagccgcaggaccgggacgatgtcatg
aggacgctgctcctgcgccacagccaccccaccgaggacgagtcggtgtggacgatgccg
ccggcgctggtgcagcgctcgggcaccacccgggccgacgtggagcggccgcttctgcgg
gagcagcggcccctggagatgagcaggatggcagggaaggagcaggtgagcggggacagg
tggcacggggggcactggggacagtggggtgcgggagatgcacctgggcacacgcacacc
ttggcacacccgctgctccgtgccctggtcccgctgcagcgggagctgctccgacggcgc
taccagcccctggagaggctgcacatcgggggcttcctgaaagacctggggccggaggag
gcggcggctgcggaggacgatgaccccctgcgcaggacggggcggcctttcggggggctg
gtgcgggacatccgccgccggtaccccaaatacctcagcgacatcaaggacgccctcaac
ccgcagtgcctggccgccgtcatcttcatctacttcgcggcgctgtcacccgcgatcacc
ttcggaggcttgctgggtgagaagaccaagggcatgatgggggtgtcggagctgctcatc
tccacctgcgtgcagtgcgtgctcttcagcctcctcagcgcccagcccctcctcgtcgtc
ggcttctcgggacccctcctggtctttgaggaagccttttactcgttctgcagcagcaat
ggcttggaatacatcgtgggacgggtgtggatcggcttctggctgatcctgctggtgctg
gtggtggtggcctgcgagggcagcttcctggtgcgctacctgtcccgctacacccaggag
atcttctccttcctcatctccctcatcttcatcttcgagaccttctccaagctggtcacg
attttcaagcaccacccgctgcagcgggagtacaacgtgcaggctgaattccagcccggg
gtgcccgagcccaacacggcgctgctgtccctcgtcctcatggccggcaccttcttcatg
gccttcttcctgcgcgtgttcaagaacagctccttcctgcccggcaaggtccggcgcttg
atcggggacttcggcgtgcccatttccatcttcatcatggcactggccgacttcttcatc
aacgacacctacacccagaaactcagcgtccccagagggctgcaggtcaccaacgcgact
gcccggggctggttcatccaccccatgggcaacaatgccccgttccccatctggatgatg
tttgcctccgtgattcccgcccttctggtcttcatcctcatcttcctcgagacacagatc
accaccctcatcgtcagcaagcccgagaggaaactggtgaagggcaccggcttccacctg
gacctgctgctgatcgtggccatgggggggctggcagccctttttgggatgccctggctc
agtgccaccaccgtccgcaccatcacccacgccaacgccctcaccatcatgagcaagacc
tctgctccgggcgagaaatcccagatcctggaggtcaaggagcagcgcatcagcggcctc
ctggtggctgtgctcattggcgtctccatcctgatggagcccatcctgaagtacatcccg
ctggccgtgctcttcggcatcttcctctacatgggggtcacctccctctttggcatccag
ctcttcgaccgcatcctgctcctgctgaagccccccaagtaccaccctgatgagccctac
gtcacccgcgtgaagacttggaggatgcacctcttcaccttcacccagatcatcttcctc
gtggtgctgtgggtggtgaagtccacgccggcctcgctggcgctgccctttgtcctcatc
ctcaccgtgcccctgcggcgcttcctgctccccaggatcttccgggacattgagctcaaa
tgtctggacgcggatgacgccgtggtgacctttgaagaggcagaggggacagatgtgtac
aacgaggtgcagatgcccagttaa

DBGET integrated database retrieval system