KEGG   Lonchura striata domestica (Bengalese finch): 110477199Help
Entry
110477199         CDS       T05897                                 

Gene name
DOCK7
Definition
(RefSeq) dedicator of cytokinesis protein 7 isoform X1
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
lsr  Lonchura striata domestica (Bengalese finch)
Brite
KEGG Orthology (KO) [BR:lsr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lsr04131]
    110477199 (DOCK7)
Membrane trafficking [BR:lsr04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    110477199 (DOCK7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N TEA
Motif
Other DBs
NCBI-GeneID: 110477199
NCBI-ProteinID: XP_021398389
Position
Unknown
AA seq 2137 aa AA seqDB search
MAERRAFAQKISRTVAAEVRKQISGQYGGSPQLLKNLNIGGSVSHHTTVPLTEAVDPVDL
EEYLNTHPLAVESGPLRDLLEFPRDDIEVVYTPRECRTLLSAVPEESEMDPHVRDCVRSY
TEDWAIVNRKYHKLGTGFNPNTLDKQKERQKGLPKQVFESDEAPDGNSYQDEQDDLKRRS
MSIDDTPRGSWACSIFDLKNSLPDALLPNLLDRTPNEEIDHHNEDQRKSSRHKELFALHP
APDEEEPIERLSVPEVPKEHFGQRLLVKCLSLKFEIEIEPIFASLALYDVKEKKKISENF
YFDLNSEQMKGMLRPHVPPAAISTLARSAIFSITYPSQDVFLVIKLEKVLQQGDIGECAE
PYMIFKESDAAKNKEKLEKLKGQAEQFCQRLGKYRMPFAWTAIHLMNIVSSAGSLERDST
EVEVGTGERKGSWSERRNSSIVGRRSLERTTSGDEACNLSSFRPATLTVTNFFKQEGDRL
SDEDLYKFLADMRRPSSVLRRLRPITAQLKIDISPAPENPHYCLTPELLQVKLYPDSRVR
PTREILEFPARDVYVPNTTYRNLLYVYPQSLNFANRQGSARNITVKVQFMYGEDPSNAMP
VIFGKSSCPEFSKEAYTAVVYHNRSPDFHEEIKIKLPATLTDHHHLLFTFYHVSCQQKQN
TPLETPVGYTWIPMLQNGRLKTGQFCLPVSLEKPPQAYSVLSPEVPLPGMKWVDNHKGVF
NVEVVAVSSLHTQDPYLDKFFALVHALDEHMFPVRIGDMRIMENNLENELKSSISALNSS
QLEPVVRFLHLLLDKLILLVVRPPVIAGQIVNLGQASFEAMASIINRLHKNLDGNQDQHG
RNSLLASYIYYVFRLPNTYPNSPSPGPGGLGGSVHYATMARSAVRPGGGNLNRSRSLSNS
NPDISGTPTSPDDEVRSIIGTKGLDRSNSWVNTGGPKAAPWGSNPSPSAESTQATDRSCN
RMSSHTETSSFLQTLTGRLPTKKLFHEELALQWVVCSGSVREAALQQAWFFFELMVKSMV
HHLYFADKLDAARKNRFPERFMDDVSALVSTIAGDIVSRFQKDTEMVERLNTSLAFFLND
LLSIMDRGFVFALIKTCYKQVSSKVYSLTNPSNLASLKLDFLRIICSHEHYVTLNLPCSL
LTPPASPSPSVSSATSQSSGFSTNVQDQKIANMFELSVPFRQQHYLAGLVLTELAVILDP
DAEGLFGLHKKVINMVHNLLSSHDSDPRYADPQVKARVAMLYLPLIGVIMETVPQLYDFT
ESHNQRGRPSCVAVDDYESEGGSMINQTVAMAIAGTSVPQLTRPSSFLLPSSSGRQHSTF
STESSRSLLICLLWVLKNADESVLQKWFTDLSVLQLNRLLDLLYLCVSCFEYKGKKVFER
MNSLTFKKSKDMRAKLEEAILGSIGARQEMVRRSRGQLERSPSGSAFGSQENLRWRKDMT
HWRQNTEKLDKSHKPARSRAEIEHEALIDGNLATEANLIILDTLEIVVQTVSVTESKESI
LGGVLKVLLHSMACNQSALYLQHCFATQRALVSKFPELLFEEETEQCADLCLRLLRHCSS
SVNTIRSHASASLYLLMRQNFEIGNNFARVKMQVTMSLSSLVGTSQNFNEEFLRRSLKTI
LTYAEEDLELRETTFPDQVQDLVFNLHMILSDTVKMKEHQEDPEMLIDLMYRIAKGYQNS
PDLRLTWLQNMAGKHSERSNHAESAQCLVHSAALVAEYLSMLEDRKYLPVGCVTFQNISS
NVLEESAVSDDVVSPDEEGICSGKYFTEAGLVGLLEQAAASFSMAGMYEAVNEVYKVLIP
IHEANRDAKKLSTIHGKLQEAFSKIVHQSTGWERMFGTYFRVGFYGTKFGDLDEQEFVYK
EPAITKLAEISHRLEGFYGERFGEDVLEVIKDSNPVDKCKLDPNKAYIQITYVEPYFDTY
EMKDRITYFDKNYNLRRFMYCTPFTLDGRAHGDLHEQFKRKTILTTSHAFPYIKTRINVI
HKEEIILTPIEVAIEDMQKKTQELAFATHQDPADPKMLQMVLQGSVGTTVNQGPLEVAQV
FLAEIPNDPKLFRHHNKLRLCFKDFTKRCEDALRKNKSLIGPDQKEYQRELERNYHRLKE
ALQPLINRKIPQLYKAVLPVTCHRDSFSRMSLRKMEI
NT seq 6414 nt NT seq  +upstreamnt  +downstreamnt
atggccgagcgccgcgccttcgcccagaagatcagcaggaccgtggcagccgaggtcagg
aagcagatttcggggcagtatggaggctccccacagctcctcaagaacctcaacatcgga
ggcagcgtctcccatcacaccactgtgcctctcacagaagctgtggaccctgtggacctg
gaggagtatctcaacacccaccctctggccgtggagtcggggcccctgcgggacctgctg
gagtttccccgcgatgacatcgaggtggtttacaccccccgcgagtgccggacgctgctg
tcggccgtgcccgaggagagcgagatggaccctcacgtgagggactgtgtcaggagttac
acggaggactgggcgatcgtgaacagaaaataccacaagctgggaactgggttcaatccc
aacaccttggacaaacagaaggagaggcaaaaagggctccccaaacaggtcttcgagtct
gatgaagctcctgatggcaacagctaccaggatgaacaagatgacctcaagcgccgctca
atgtcgatcgacgacactccccggggcagctgggcctgcagcatcttcgacctgaagaac
tccctgcctgatgccctcctcccaaacctgctggacagaaccccaaacgaggagattgac
caccacaacgaggaccagaggaagtccagtaggcataaggagctttttgcactacaccca
gcaccagatgaggaggagcccatagagagactcagtgtccctgaagtacccaaagagcac
tttggccaaagactcttggtgaagtgtttgtccctgaaatttgaaatagaaattgagccc
atttttgcaagtttggctttgtatgatgttaaagaaaagaagaagatttcagagaatttc
tactttgatttaaactctgagcaaatgaagggaatgcttcggcctcatgtcccccctgct
gctatttccaccctggccagatctgccatcttttctatcacctacccatcgcaagatgtc
tttctagtaataaagctggaaaaagttttacagcagggagatattggggagtgtgctgag
ccttatatgatttttaaagaatctgatgcagcaaagaacaaggaaaagttggaaaaactg
aagggccaggcagagcagttttgccaaagactcgggaagtaccggatgccttttgcctgg
acagccattcacctcatgaacattgtgagcagtgctggcagcttggaaagagattccaca
gaagttgaagttggcacaggagagcgtaaggggtcgtggtcggagcggcggaactccagc
atcgtcgggaggcgctccctggagagaaccacgagtggggacgaggcttgcaacctgagc
agcttcaggccagccaccctgacagtgaccaacttcttcaaacaggagggggatcgcctg
agcgatgaggacctctacaagttcctggctgacatgagacgtccctcgtcggtgctgcgc
aggctcagacccatcacagctcagttgaagatagacatatctccagctccagagaatccc
cactactgcctaaccccagagctgctgcaggtcaagctttacccagacagcagagtcaga
ccaacaagagaaatcctggagttccctgccagggatgtctacgtcccaaacaccacttac
aggaatctcctttatgtgtacccacagagccttaacttcgccaaccgccagggatctgcc
aggaacatcacagtgaaagtgcagttcatgtatggagaggatcccagcaatgccatgccg
gtcatctttggcaaatccagctgtcctgagttttccaaggaagcttacacagctgtggtg
tatcacaacagatctcctgattttcacgaggaaatcaagattaagcttccagccactttg
acagaccaccaccacctactttttactttctaccatgtcagttgccaacaaaaacaaaac
acacctctggagactccagtcggctacacttggatcccgatgctgcagaatggccggtta
aagacgggtcagttctgtcttcctgtgtcattggaaaagccacctcaggcttattcagtg
ctttctccagaggttcctctccctgggatgaagtgggtggataaccacaaaggggttttc
aatgtggaagttgttgctgtgtcatccctccacactcaggacccttacctcgacaagttc
tttgcacttgtccatgctctggatgagcacatgttccctgtgcgaataggagacatgaga
attatggaaaacaacttggaaaatgaactgaagagcagcatttcagctttaaattcctct
caactggagccggtagtgcgatttcttcatctcctgcttgacaaactgatccttctggta
gtaagacctcctgtcattgcaggccaaatagtgaacctgggccaggcgtcttttgaggcg
atggcatccatcataaacagacttcacaagaacttggatggcaaccaggaccagcatggc
aggaacagcctgcttgcttcctatatttattatgtttttcgcttacccaacacctatccc
aactcaccatcaccaggtcccggcggcctgggggggtccgtgcactacgccaccatggcc
aggtcggccgtgcgtcccggggggggcaacctgaaccgctcgcgcagcctcagcaacagc
aaccccgacatctccggcacccccacctcgcccgacgacgaggtgcgctccatcatcggc
accaagggcttggaccgctccaattcctgggtaaacactggtggtccaaaagcagcccca
tggggatccaaccccagcccaagtgcagagtcaacacaggctacggatcgaagttgtaat
cgtatgtcttcgcacactgagacgtcaagtttcttacaaacattaacaggacgattacca
accaaaaagcttttccacgaggagctggccctgcagtgggttgtgtgcagcgggagcgtg
cgggaggcggcccttcagcaggcctggttcttcttcgagctgatggtgaagagcatggtg
catcatctgtattttgctgacaaactggatgcggcgaggaagaatcgtttcccggagcgc
ttcatggatgacgtgtctgcactggtcagcacaattgctggtgatatagtctcccgcttc
cagaaggacacggaaatggtggagcggctcaacaccagtctcgcgtttttcctcaatgat
ttgttgtccatcatggacagaggatttgtttttgctcttattaagacctgctacaaacag
gtgtcttcaaaggtgtattccttaacaaatccaagcaacctggcatctctgaagctggac
ttcctgcgcatcatttgcagccatgagcactatgtcaccttgaatttaccctgcagcttg
ctcacaccacctgcatctccatcaccatctgtgtcttcagccacttcccagagttctggg
ttctccaccaatgtccaagaccagaagattgcaaatatgtttgagttgtctgtgcctttc
cgccagcagcattacctggccgggctggtgctcacagaactggctgtcattctagatcct
gatgcagaaggtttatttggattgcataagaaggtcatcaacatggtacacaacctgctg
tccagccacgactcggacccgcggtacgctgacccccaggtaaaggcccgggtggcaatg
ctgtatctacctctgatcggcgtgatcatggaaactgtgcctcagctctatgacttcaca
gagagtcacaaccagcgggggaggccgagctgtgttgctgtggatgattacgagagcgag
ggtggcagcatgatcaaccagacagtggccatggccattgcagggacttctgtcccccag
ctcaccaggcccagcagtttcctactcccttcttcgagtggcaggcagcactccaccttc
tcaacagagtccagccgcagcctcctcatctgcctgctgtgggtgctgaagaacgcggac
gagagcgtcctgcagaagtggttcactgacctgtcagtgctgcagctcaaccgcctgctg
gacctgctctatctctgtgtctcctgctttgagtacaagggcaagaaagtgtttgaaaga
atgaacagtctgacatttaagaagtcaaaagacatgagagccaaacttgaagaagcaatt
ttgggcagcataggagcaagacaggaaatggtccgaagaagtagaggacagctggagagg
agcccttctgggagtgcctttggaagtcaagagaatctgaggtggagaaaggatatgact
cactggcggcagaacacagagaagcttgacaaaagccacaaaccagccaggtcaagggca
gagatagagcacgaagcactcattgatgggaatcttgcaacagaagccaacctgataatt
ttggatactctagagatagttgtacagactgtgtccgtgacggagtccaaggagagcatc
ctcggcggggtgctcaaagtgctgctgcacagcatggcctgcaaccaaagtgccctttac
ctccagcactgctttgccacacagagagctttggtctcaaagttccctgagctgctgttt
gaggaggagacagagcagtgtgcagacctgtgcctgaggctcctgaggcactgcagcagc
agcgtcaacaccatcaggtcccacgccagtgcctccctgtacctcctcatgaggcagaac
ttcgagatcggcaacaattttgccagagtgaagatgcaggtgaccatgtccctctcatcc
ctggtggggacatcccagaacttcaatgaagaatttctgcggcgttccctcaagactatt
ctgacatatgctgaagaggatctggagcttagggagacaacatttcctgaccaggtccag
gatttagtgttcaacctccatatgatcctgtcagacacagttaaaatgaaggagcaccag
gaagatccagaaatgctgattgacctgatgtacaggattgccaagggctaccagaattcc
cccgacctgaggctgacgtggctgcagaacatggcagggaaacattctgagaggagtaac
cacgccgagtctgcccaatgcctggtgcactctgcagccctggtggcagagtacctgagc
atgctggaggacaggaaatacctccctgtgggctgtgtgacattccagaacatatcttcc
aatgttttggaagagtcagcagtttctgatgatgttgtgtccccagatgaagaaggaatc
tgttctgggaagtattttacagaagctggtctggtgggattgctggaacaggctgcagca
tctttctccatggctggcatgtatgaagcagttaatgaggtttacaaagtccttattcct
attcatgaagccaacagagatgccaagaagttgtctactattcatggtaaactgcaggaa
gcattcagcaagattgttcaccagagtactggctgggagaggatgtttggcacctacttc
cgagttggtttttatggaactaagtttggagacctggatgagcaagagtttgtttacaag
gaacctgcaataaccaagttggctgaaatctcccatcggctggaggggttttatggagaa
cggtttggggaagatgtgctggaagtgatcaaggactcaaaccctgtggacaaatgtaaa
cttgatcccaacaaggcctacatccagatcacctatgtggagccctacttcgacacgtac
gagatgaaggacaggatcacctacttcgacaagaactacaacctgcggcgcttcatgtac
tgcacgcccttcacgctggacggccgcgcccacggcgacctgcacgagcagttcaagcgc
aagaccatcctcaccacctcccacgccttcccctacatcaaaaccaggatcaacgtcatc
cacaaggaggagatcattttgacccccatcgaagtcgccatcgaggacatgcagaagaaa
acccaggaactggcttttgccacccaccaagaccccgcagaccccaagatgctgcagatg
gtgctgcagggatcagtaggtaccacagtgaatcagggaccgttagaagttgcacaagtt
ttcttggctgaaatccccaatgatccaaagctcttcagacaccacaacaaactccgcctc
tgcttcaaggacttcaccaaaaggtgtgaggatgccctgaggaagaacaagagcctgatc
gggccggaccagaaggaatatcagcgggagctggagcgcaactaccaccggctcaaggag
gctctgcagcccctgatcaacaggaagatcccacagctctacaaggcagtgctgcctgtc
acgtgccacagagactccttcagcaggatgagccttcgcaaaatggaaatctaa

DBGET integrated database retrieval system