KEGG   Lonchura striata domestica (Bengalese finch): 110479536Help
Entry
110479536         CDS       T05897                                 

Gene name
DDC
Definition
(RefSeq) aromatic-L-amino-acid decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
lsr  Lonchura striata domestica (Bengalese finch)
Pathway
lsr00350  Tyrosine metabolism
lsr00360  Phenylalanine metabolism
lsr00380  Tryptophan metabolism
lsr01100  Metabolic pathways
Module
lsr_M00037  Melatonin biosynthesis, tryptophan => serotonin => melatonin
lsr_M00042  Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:lsr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    110479536 (DDC)
   00360 Phenylalanine metabolism
    110479536 (DDC)
   00380 Tryptophan metabolism
    110479536 (DDC)
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    110479536 (DDC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lsr04147]
    110479536 (DDC)
Enzymes [BR:lsr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     110479536 (DDC)
    4.1.1.105  L-tryptophan decarboxylase
     110479536 (DDC)
Exosome [BR:lsr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110479536 (DDC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 110479536
NCBI-ProteinID: XP_021402587
Position
Unknown
AA seq 485 aa AA seqDB search
MDAAEFRKRGKEMVDYVADYLEKIEKRQVFPDVEPGYLRPLIADCAPQDPESFEDVFKDI
EKVIMPGVTHWHSPYFFAYFPAASSFPALLADMLCGGIGCVGFSWAASPACTELETVMLD
WLGKMVNLPEEFLAGKDGQGGGVIQGSASEATLIALLAARTKTIRQIQSEKPELTETEIM
GRLVAYASDQAHSSVERAALIGAVKIKNVPSDDTFSVCGSALRKVLDEDKAAGLIPFFFC
ATLGTTPCCSFDKLLELGPICNKENIWMHIDAAYAGSAFICPEFRHLLDGVEFADSFNFN
PHKWLLVNFDCSAMWVKKRSDLIGAFKLEPLYLQHHHQESGLVTDYRHWQIPLGRRFRSL
KLWFVLRMYGVKGLQEHIRKHIRLSHQFEHLVLQDERFEICAEVVLGLVCFRLKGSNELN
KALLKLINDAKKIHLVPCNLREKFVLRFAICSRTVESTHIKFAWQHISQLATDLLKTWEQ
NHHQQ
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggatgctgcagaatttcgcaagagagggaaggagatggtggattatgttgcggattac
ctggagaagatagagaaacgacaggtattcccagatgtggaaccaggatacctacggccc
ctcatcgcagactgtgcaccccaggatcctgagagctttgaggatgtctttaaagacatt
gagaaggtcattatgccaggggtgactcactggcacagtccgtacttttttgcctacttc
cctgcagcctcttccttcccagctcttcttgcagatatgttgtgtggtggaataggatgt
gtgggcttctcttgggctgcaagtccagcttgcacagagctggagactgtcatgctggat
tggcttgggaagatggttaatttgcctgaggagtttttagctgggaaggatggccaaggt
ggaggagtcattcagggaagtgcaagtgaggccaccctgattgcactgcttgctgcaagg
acaaaaactatcagacagatacagtcagagaagcctgagctgacagaaacagagatcatg
ggcaggctggtggcttatgcttctgatcaggctcattcatctgtggaaagggctgcacta
attggtgctgtgaagattaaaaatgttccttcagatgacacatttagtgtttgtggttca
gccctgaggaaagttctggatgaagacaaagctgctggtcttataccattctttttctgt
gcaacacttggaaccaccccttgctgctcctttgacaagctgctagaactgggtcctatt
tgtaataaggaaaatatctggatgcatattgatgcagcctatgcaggaagtgctttcatc
tgccctgaattcaggcatcttttagatggagtggagtttgcagattcatttaactttaat
cctcacaaatggctcctagtgaattttgactgctctgcaatgtgggtgaaaaaaagatca
gatttaataggtgcctttaaattagaacctctttacctgcagcatcaccatcaggagtct
ggtcttgtaacagattatcggcactggcaaatccccctgggcaggaggttccgctccctg
aagctctggttcgtgctgaggatgtacggggtcaaggggctgcaggagcacatccgcaag
cacattagactgtcacatcagtttgaacacttggtccttcaggatgaaaggtttgagatc
tgtgctgaggttgttttgggactggtctgcttccggctgaagggctcaaatgaactaaac
aaggcacttctaaaactcataaatgatgccaagaagatccatctggtcccgtgcaacctc
cgagagaagtttgtgctacgttttgctatttgttcccgcacagtggaatccacccacatc
aagtttgcctggcagcacatctcacagctggcaactgatcttctgaaaacatgggagcaa
aaccatcaccagcagtaa

DBGET integrated database retrieval system