KEGG   Lonchura striata domestica (Bengalese finch): 110479549Help
Entry
110479549         CDS       T05897                                 

Gene name
CACNG3
Definition
(RefSeq) voltage-dependent calcium channel gamma-3 subunit
  KO
K04868  voltage-dependent calcium channel gamma-3
Organism
lsr  Lonchura striata domestica (Bengalese finch)
Pathway
lsr04010  MAPK signaling pathway
lsr04260  Cardiac muscle contraction
lsr04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:lsr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110479549 (CACNG3)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    110479549 (CACNG3)
   04261 Adrenergic signaling in cardiomyocytes
    110479549 (CACNG3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lsr04040]
    110479549 (CACNG3)
Ion channels [BR:lsr04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   110479549 (CACNG3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2
Motif
Other DBs
NCBI-GeneID: 110479549
NCBI-ProteinID: XP_021402603
Position
Unknown
AA seq 315 aa AA seqDB search
MRMCDRGVQMLVTTVGAFAAFSLMTIAVGTDYWLYSRGVCRTKSMSDNDTSRKNEEVMTH
SGLWRTCCLEGTFRGVCKKIDHFPEDADYEQDTAEYLLRAVRASSIFPILSVGLLFFGGL
CVAASEFYKSKHNVILSAGIFFVSAGLSNIIGIIVYISANAGDPGQSDSKKSYSYGWSFY
FGALSFIIAEMVGVIAVHMYIEKHRQIRARSHSELLKRSAFTRLPPYRYRFRRRSSSRST
EPRSRDMSPISKGFGTIPSTDISMFTLSRDPSKVTMGTLLNSERDHGFLQVHNSIPKEFK
ESLHNNPANRRTTPV
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaggatgtgtgacagaggcgtccagatgctcgtcaccacggtgggagccttcgcagcc
ttcagcctgatgaccatcgccgtgggcaccgactactggctctactcgcgcggcgtgtgc
aggactaagtccatgagcgacaacgacacgagccgcaagaacgaggaggtgatgacccac
tcggggctctggaggacgtgctgcctggaaggaaccttccgaggagtgtgcaagaaaatc
gaccacttccctgaggatgcagactacgagcaagacacggccgagtatctcctccgtgcg
gtgagagcctccagcatcttccccatcctcagtgtggggctgctgttcttcgggggcctg
tgcgtggccgccagcgagttctacaagagcaaacacaacgtcatcctcagcgccggcatc
ttcttcgtctctgcaggtctcagcaacatcatcgggatcatagtctacatctcggccaac
gcgggggacccgggccagagcgactccaagaagagctactcctacggctggtccttctac
ttcggggcgctgtccttcatcatcgccgagatggtgggggtgatcgccgtgcacatgtac
atcgagaagcaccgccagatccgcgcccgctcccactcggagctgctcaagaggtcggcc
ttcacccgcctgccgccctaccggtaccgcttccgccggcgctccagctcccgctccacc
gagccccgctcccgggacatgtcgcccatcagcaaaggcttcggcaccatcccctccacc
gacatctccatgttcacgctctccagggatccctccaaggttaccatgggcacgctgctc
aactcggagcgggaccacggttttttacaggtccacaactccatccccaaagagttcaag
gagtctttgcacaacaacccggccaacagacgaaccacgccggtctga

DBGET integrated database retrieval system