KEGG   Lonchura striata domestica (Bengalese finch): 110479714Help
Entry
110479714         CDS       T05897                                 

Gene name
HTR4
Definition
(RefSeq) 5-hydroxytryptamine receptor 4 isoform X1
  KO
K04160  5-hydroxytryptamine receptor 4
Organism
lsr  Lonchura striata domestica (Bengalese finch)
Pathway
lsr04020  Calcium signaling pathway
lsr04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:lsr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    110479714 (HTR4)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110479714 (HTR4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:lsr04030]
    110479714 (HTR4)
G protein-coupled receptors [BR:lsr04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    110479714 (HTR4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 Pex14_N
Motif
Other DBs
NCBI-GeneID: 110479714
NCBI-ProteinID: XP_021402869
Position
Unknown
AA seq 450 aa AA seqDB search
MEELDVNVSSSEAFGIAEKIVLLSFISAVILMAILGNLLVMVAVCRDRQLRKIKTNYFIV
SLAFADLLVSVLVMPFGAMELVQDNWIYGEMFCLVRTSLDVLLTTASILHLCCISLDRYY
AICCQPLVYRNKMTPLRIALMLGGCWIIPTFISFLPIMQGWNSIGIIDLIQQRQFNKASN
STYCIFMVNKPYAITCSVVAFYIPFLLMVLAYHRIYVTARAHARQIRLLQRAGNPAETRQ
GHQEPRQGHQEPRQGHQEPRQGHQEPWQGHQEPRQGHQELRQGHQEPRQGHQEPRQGHQE
PRQNPPDQHSTHRMKTETKAAKTLCIIMGCFCLCWAPFFVTNIVDPFINYTVPGKLWTAF
LWLGYINSGLNPFLYAFLNKAFRRAFLIILCCGDERYRRPSILGQTVPCSTTTINGSTHV
LRYTVLHNGHHQEQEKLPIHTDPESQESCF
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atggaagagcttgatgtgaatgtgagttcgagtgaggccttcggcatcgcggagaagatc
gtgctgctctccttcatctccgccgtcatcctgatggccatcctgggcaacctgctggtc
atggtggccgtgtgccgggacaggcagctcaggaaaatcaagaccaactatttcattgtt
tccctggccttcgctgacctgctggtgtcggtgctggtgatgccctttggggccatggag
ctggttcaggacaattggatctatggagagatgttctgcctggtgaggacctcgctggac
gtgctgctgaccacggcgtccatcctgcacctctgctgcatctccctggacaggtactat
gccatctgctgccagcccctggtgtacaggaacaagatgaccccgctgcgcatcgcgctg
atgctggggggctgctggatcatcccaaccttcatttccttcctccccatcatgcagggc
tggaatagcattggcatcattgatctgatccagcagagacagttcaacaaggcctccaac
tccacctactgcatcttcatggtgaacaagccctacgccatcacctgctccgtggtggcc
ttctacatccccttcctgctgatggtgctggcctaccaccgcatctacgtgacggcgcgg
gcgcacgcgcggcagatccgcctgctgcagcgcgcggggaacccggccgaaacccggcag
ggccaccaggagccacggcagggccaccaggagccccggcagggccaccaggaaccccgg
cagggccaccaggagccatggcagggccaccaggaaccccggcagggccaccaggaactc
cggcagggccaccaggaaccccggcagggccaccaggagccacggcagggccaccaggag
ccacggcagaacccccccgaccagcacagcacccaccgcatgaaaaccgagaccaaagcc
gccaagaccctgtgcatcatcatgggctgcttctgcctctgctgggcccccttcttcgtc
accaacatcgtggatcccttcattaactacacggtgcccggcaagctgtggacggccttc
ctgtggctgggctacatcaactcgggcttgaaccctttcctctacgccttcctcaacaag
gctttcagacgtgccttcctcatcatcctgtgctgcggcgacgagcgctaccgaaggcct
tccatcctgggccagaccgtgccctgctccaccaccaccatcaacggctccacgcacgtg
ctgaggtacacggtgttacacaacgggcaccaccaggaacaagagaagcttcccatccac
accgaccccgaatcccaagaatcctgtttctag

DBGET integrated database retrieval system