KEGG   Lonchura striata domestica (Bengalese finch): 110480337
Entry
110480337         CDS       T05897                                 

Gene name
MECOM
Definition
(RefSeq) histone-lysine N-methyltransferase MECOM
  KO
K04462  ecotropic virus integration site 1 protein
Organism
lsr  Lonchura striata domestica (Bengalese finch)
Pathway
lsr04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:lsr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110480337 (MECOM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lsr03000]
    110480337 (MECOM)
Transcription factors [BR:lsr03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    110480337 (MECOM)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_jaz zf-H2C2_5 zf-BED Zn-ribbon_8 zinc_ribbon_15 zf-C2H2_11 zf-Di19 PyrI_C zf-C2H2_8
Other DBs
NCBI-GeneID: 110480337
NCBI-ProteinID: XP_021403868
Position
9
AA seq 911 aa
MRSKGRARKLAASDECLYESFPELPLGEVPEADGEAANVQCPTSISIQEPSSPATSSEAF
TPKESSPYKAPIYIPDDIPIPSEFELRESNIPGAGLGIWTKRKIEAGEKFGPFVGEQRPH
LKDPSYGWEILDEFCNVKFCIDASQPDVGNWLKYIKFAGCYNQHNLVACQISDQIFYRVV
ADIEPGEELLLFMKSEDYSHETMAPDIHEERQYRCEDCDQLFESKAELVDHQKFPCSTPH
SAFSMVEEDFQKKLENENDLQDVHEIQECKECDQVFPDLQSLEKHMLSHSEEREYKCDQC
PKAFNWKSNLIRHQMSHDSGKHYECENCAKVFTDPSNLQRHIRSQHVGARAHACPECGKT
FATSSGLKQHKHIHSSVKPFISFSQSMYPFPDRDLRPLPLKVEPQSPSEIKKIPKGSSES
PFDLTIKRKEEKPLTPIPSKPAAPSASSQDQPLDLSMGSRSRASSTRQAEPRKNHVFGEK
KGGDLEQRKASESSLQHARPTPFFMDPIYRVEKRKLTDPLEALKEKYLRPSPGFLFHPQV
SAIENMAEKLESFSALKPEASELIQSVPSMFNFRAPPSALPETLLRKGKERYTCRYCGKI
FPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHVRNIHNKEKPFKCHLCDRCFGQ
QTNLDRHLKKHENGNMSGTATSSPHSELESTGAILDDKEDSYFTEIRNFIGNSNHNNQSP
RNSEERMNGSHFKDEKAMVASQNSDLLDDEEAEDEVMMDEEDEESEMAGKAVKEPVPSDM
HEGTPEEDYEETSTLDMNCKASPGRYKEEEYSKTGLSALDHIRHFTDSLKMRKMEENQYS
EAELAAFNASQLPEDLKQPLYRKSKSQAYAMMLSLSDKDSLHSASHSSPNMWHSMARAAA
ESSAIQSISHV
NT seq 2736 nt   +upstreamnt  +downstreamnt
atgcgatccaagggcagggcgaggaagctggccgcaagtgatgaatgtttgtatgagagc
tttccagaacttcccttgggggaagtgccagaagctgatggagaggctgcaaatgtccag
tgtccaacatccatcagcatccaagagccgtcttctccagcgacctccagcgaagctttc
acacccaaggagagctctccttacaaggctccaatatacattcctgatgacattcccatt
ccttcagagtttgagctcagagaatccaacattcctggagcaggattagggatatggacc
aaaaggaagattgaagcaggggaaaaatttggcccttttgtaggagagcagcggccacac
ctgaaagaccctagttacggctgggagatcttggatgagttttgcaatgtgaagttctgc
atagatgccagtcaaccagatgtaggaaactggctcaaatatatcaagtttgctggatgc
tacaatcagcacaaccttgttgcatgtcaaataagtgatcagatattctacagagtggta
gcagatattgaaccaggagaggaactcttactgttcatgaagagtgaagattattcacat
gaaacaatggctccggacatccacgaggagcgccagtaccgctgcgaggactgtgaccag
ctctttgagtccaaggctgagctggtggaccaccagaagttcccctgcagcacacctcac
tccgccttctccatggtggaggaggacttccagaagaagctggagaacgagaatgacctt
caggacgtgcatgaaatccaggagtgtaaagagtgtgaccaggtcttcccagacttacaa
agcctggagaagcacatgctgtcacacagcgaggagagggagtacaagtgtgaccagtgc
cccaaagcttttaactggaagtccaacttgatacgtcaccaaatgtcccacgacagcggg
aagcactacgagtgtgagaactgtgccaaggttttcacggaccccagcaaccttcagagg
cacattcgttcccagcatgtgggggctcgtgctcacgcttgtccagagtgtggcaaaacc
tttgccacttcttcgggcctcaaacagcataaacacatccacagcagtgtcaaacctttt
atatcattctctcaatcaatgtatccatttcctgatagagacttgagaccgttacccttg
aaagtggagccccaatcacccagtgaaattaagaagatcccaaagggaagctctgagtct
ccctttgacctcaccataaaacgtaaggaggagaagccacttactcccatcccctcaaag
ccagcagccccctctgcatccagccaggaccagcctctggatctcagcatgggcagccga
agccgagccagcagcacgaggcaagctgagcctcggaaaaaccacgtctttggagagaag
aaaggaggagacctcgagcagaggaaagcttcagagtcctctttgcagcacgccaggccc
accccattctttatggatcccatatacagagtagaaaaaagaaagctaactgacccactg
gaagctttaaaagagaaatacttgagaccttccccgggattcttgtttcatccacaagtg
tcagctatagagaacatggccgagaagctggagagcttcagcgccctgaagccggaggcc
agcgagctgatccagtcggtgccatccatgttcaacttccgcgcgccgcccagcgcgctc
cccgagacgctgctgcgcaagggcaaggagcgctacacctgcagatactgtggcaagatt
ttcccaagatctgcaaacctgacccgtcacctgaggacgcacactggagagcagccctat
agatgcaaatactgtgacagatcctttagcatatcctctaacctgcagagacatgtgcgt
aacatccacaataaagagaagccattcaagtgtcacttgtgtgacaggtgttttggtcaa
caaaccaatcttgacagacatctaaaaaagcacgagaacgggaacatgtctggtactgca
acatcctcacctcactcagaactggaaagcacaggggcaatcctagatgacaaggaagac
tcctacttcacagaaattaggaattttattggaaatagcaaccacaacaatcaatccccc
cgaaactcagaggagagaatgaatggcagccactttaaggatgaaaaagccatggtagcc
agccagaactcggatctgctggatgacgaggaggcagaagatgaagtaatgatggatgaa
gaggatgaagagagcgaaatggcagggaaagcagtcaaagagcccgtgccgagtgacatg
catgagggcactcccgaggaggattacgaggaaacgagtactttggacatgaactgcaaa
gcttcccctggcaggtataaagaagaggagtatagtaagactggactttcagctttggac
cacataaggcacttcacagatagcctcaaaatgaggaaaatggaagaaaatcaatacagt
gaagctgaattggcagctttcaatgcttcccagctgccagaggacctcaagcaaccgttg
tacaggaaatccaaatcccaggcctatgccatgatgctctccctctccgacaaggactcc
cttcattctgcatcccacagttctcccaacatgtggcacagtatggcgagagccgccgcg
gaatccagcgccatccagtccatcagccacgtatga

DBGET integrated database retrieval system