KEGG   Lonchura striata domestica (Bengalese finch): 110481767Help
Entry
110481767         CDS       T05897                                 

Definition
(RefSeq) very long-chain acyl-CoA synthetase-like
  KO
K08746  solute carrier family 27 (fatty acid transporter), member 2 [EC:6.2.1.- 6.2.1.3]
Organism
lsr  Lonchura striata domestica (Bengalese finch)
Pathway
lsr03320  PPAR signaling pathway
lsr04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:lsr00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    110481767
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    110481767
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:lsr01004]
    110481767
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lsr02000]
    110481767
Enzymes [BR:lsr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     110481767
    6.2.1.-  
     110481767
Lipid biosynthesis proteins [BR:lsr01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   110481767
Transporters [BR:lsr02000]
 Solute carrier family (SLC)
  SLC27: Fatty acid transporter
   110481767
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 110481767
NCBI-ProteinID: XP_021406208
Position
Unknown
AA seq 416 aa AA seqDB search
MSTHGQLGGVLGFSSSPVPPGRCPTGLPKAAVITELKLMMVASLGRICGLRPDDVVYTTL
PLYHSAGLLVGLGGCLDVGATCVLRSKFSASQFWPDCRRYNVSVIQYVGELMRYLCNAPE
RAEERAHGVRLALGNGLRADVWRHFQRRFGPVAVREFYGATEGNAGFVNYSGRVGAVGRA
NAFLRFFAPFELIRYDVEREAPARDERGLCIPTRPGETGLLVVKITKNTPFHGYAGDSQK
TQKKILRDVLAKGDAFFNSGDLLMMDAEKFIYFQDRVGDTFRWKGENVATTEVEAALGLV
SFIQEVNVYGVAVPGCEGRCGMAAVRLKDGATFDGDKLYTFTEETLPAYAAPRFVRIQAA
LETTGTFKQCKTNLVKEGFDPGLVRDRLFFRDAARRSYVPLSAAAFAAIRDGRLAL
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgtccacacacgggcagcttggaggggtcctgggtttctcctcctctcctgtcccaccc
gggcgctgtcccacagggctgcccaaggccgcggtgatcacggagctgaagctgatgatg
gtggccagcctgggccggatctgcggcctgcggcccgacgacgtcgtctacaccacgctg
ccgctctaccactcggccgggctgctggtggggctgggcggctgcctggacgtcggagcc
acctgcgtcctccgctccaagttctccgcctcccaattctggcccgactgccgccgctac
aacgtctccgtcatccagtacgtgggcgagctgatgcgctacctgtgcaacgcccccgag
cgcgccgaggagcgggcgcacggcgtgcggctggcgctgggcaacggcctgcgggccgac
gtgtggcggcacttccagcggcgcttcgggcccgtggccgtgcgcgagttctacggcgcc
accgagggcaacgccggcttcgtcaactacagcggccgcgtgggcgccgtgggccgcgcc
aacgccttcctcaggttcttcgcgccgttcgagctgatccgctacgacgtggagcgcgag
gcgccggcgcgcgacgagcgcggcctctgcatccccacccggcccggtgagacggggctg
ctggtggtgaagatcaccaagaacacgccgttccacggctacgccggcgactcgcagaag
acccagaagaagatcctcagggacgtcctggccaaaggcgacgccttcttcaacagcggc
gacctcctcatgatggacgccgagaagttcatctacttccaggaccgcgtcggggatacc
ttccgctggaaaggggagaacgtggccaccacggaggtggaggccgcgctgggcttggtg
agcttcatccaggaggtcaacgtctacggcgtggccgtgccggggtgcgagggccgctgc
ggcatggccgccgtgcgcctcaaggacggcgccaccttcgatggtgacaagctctacacc
ttcacggaggagacgctgcccgcctacgccgcgccccgcttcgtccgcatccaggccgct
ctggagaccaccggcaccttcaagcagtgcaagaccaacctggtcaaggagggcttcgac
cccggcctggtcagggaccggctcttcttccgcgacgccgcgcgccgctcctacgtgccg
ctgagcgccgccgccttcgccgccatccgcgacgggcgcctcgccctctaa

DBGET integrated database retrieval system