KEGG   Lonchura striata domestica (Bengalese finch): 110482685Help
Entry
110482685         CDS       T05897                                 

Gene name
GPX3
Definition
(RefSeq) glutathione peroxidase 3
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
lsr  Lonchura striata domestica (Bengalese finch)
Pathway
lsr00480  Glutathione metabolism
lsr00590  Arachidonic acid metabolism
lsr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lsr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    110482685 (GPX3)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    110482685 (GPX3)
Enzymes [BR:lsr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     110482685 (GPX3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx
Motif
Other DBs
NCBI-GeneID: 110482685
NCBI-ProteinID: XP_021407781
Position
Unknown
AA seq 228 aa AA seqDB search
MAGCSRSSWILPLVLAGLVQLGRSEEREKVDCYPSVNDTIYSYGALTIDGDEYIPFERYK
GKTVLFVNVATYUGLTLQYVELNALQDELRNEGLVVLGFPSNQFGKQEPGQNSEILPALK
YVRPGGGFVPNFQLFQKGDVNGAKEQKIFTFLKNACPPVAEDFGNPNRLFWEPLRNHDIK
WNFEKFLVSPEGVPIMRWYHRTNIAVVKKNIVSYLRRRQQNHDEQQDQ
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atggcgggctgctcccgcagcagctggattttgccccttgtcttggctgggctcgtccag
ctggggcgaagcgaggagagggagaaggtggactgctacccctcggtgaatgacaccatc
tacagctatggggccctgaccatcgatggggatgagtacatcccctttgagaggtacaag
gggaagacagtgctcttcgtcaacgtagccacatactgaggcctgaccctgcagtatgtt
gaactgaatgcactacaagatgagctgagaaatgaggggctcgtggtccttggtttcccc
tccaaccaatttgggaagcaggaacccggccagaactcagagatcctccctgcccttaag
tacgtcaggccaggaggtggctttgttcccaacttccagctattccagaaaggggatgtg
aacggggccaaggagcagaagatcttcaccttcctgaagaacgcctgtcccccggtggcg
gaggactttgggaaccccaacaggctcttctgggagcctctgcggaaccatgacatcaag
tggaacttcgagaagttcctggtgagccccgagggtgtgcccatcatgcgctggtaccat
cgcaccaacattgctgtcgtgaagaaaaacatcgtgagctacctgaggcggcggcagcag
aaccatgatgaacagcaggaccagtag

DBGET integrated database retrieval system