KEGG   Lonchura striata domestica (Bengalese finch): 110482699Help
Entry
110482699         CDS       T05897                                 

Gene name
GRIA1
Definition
(RefSeq) glutamate receptor 1 isoform X1
  KO
K05197  glutamate receptor 1
Organism
lsr  Lonchura striata domestica (Bengalese finch)
Pathway
lsr04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:lsr00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110482699 (GRIA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lsr04040]
    110482699 (GRIA1)
Ion channels [BR:lsr04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   110482699 (GRIA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3 DUF659 Peripla_BP_6
Motif
Other DBs
NCBI-GeneID: 110482699
NCBI-ProteinID: XP_021407812
Position
Unknown
AA seq 902 aa AA seqDB search
MQHIFAFFCTSFLGAVLGANFPNNIQIGGLFPNQQSQEHAAFRFALSQLTEPPKLLPQID
IVNISDSFEMTYTFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPSFPVETSNQ
FVLQLRPELQDALISVIEHYSWQKFVYIYDADRGLSVLQKVLDTAAEKNWQVTAVNILTT
TEEGYRLLFQELEKKKERLVVVDCETERLNIILNKIISLEKNGNGYHYILANMGFMDIDL
TKFRESGANVTGFQLVNYTDTVPARIMQQWRNNDAREHPRVDWKRPKYTSALTYDGVRVM
AEAFQNLRRQRIDISRRGNAGDCLANPAVPWGQGIDIQRALQQVRFEGLSGNVQFNEKGR
RTNYTLHVIEMKHDGIRKIGYWNEDEKLVPIAVDTQSGNESTSLQNRTYIVTTILEDPYV
MLKKNANQFEGNERYEGYCVELAAEIAKHVGYHYRLEIVRDGKYGARDPDTKTWNGMVGE
LVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIW
MCIVFAYIGVSVVLFLVSRFSPYEWHTEECEEGRDQPANEQTNEFGIFNSLWFSLGAFMQ
QGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIA
YGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLES
TMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRGPVNLAVLKLSEQGVLDKLKSKW
WYDKGECGSKDSGSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMK
GFCLIPQQSINEAIRTSTLPRPAAAGGSGENGRVVSHDFPKSMQTIPCMSHSTGMSLGAT
GL
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
atgcagcacatttttgccttcttctgcaccagttttctaggggcggtgttaggggccaat
ttccccaacaatatccagataggggggttatttcctaatcaacagtcccaggaacatgcg
gcttttaggtttgcattgtctcagctcacagaaccccctaagctccttccccagatcgac
attgtgaacatcagtgacagctttgaaatgacttacaccttctgctcacagttctccaag
ggtgtctatgccatcttcgggttttatgagaggaggactgtcaacatgctcacgtctttc
tgcggggccctccacgtctgcttcataacgccgagcttccccgtggaaacctccaaccag
ttcgtcctgcagctccgccccgagctgcaggatgccctcatcagcgtcatcgagcactac
agctggcagaagttcgtgtacatttacgacgctgaccgggggttgtcagtcctgcagaaa
gtgctggacactgcagctgagaagaactggcaggtgacagctgtcaacatcctgacaaca
acagaggagggctaccgactgctcttccaggagctggagaagaagaaggaaaggctggtg
gtggtggactgcgagactgagaggctgaacatcatccttaacaagatcatctcgcttgaa
aaaaacgggaatgggtaccactacattctggcaaatatgggattcatggacattgacctg
accaaattcagagagagtggagccaatgtcactggcttccaactggtgaattacacagat
actgttcctgccaggatcatgcaacagtggaggaataatgatgccagagagcatccacgt
gtggactggaagaggccaaagtacacgtcggcgctcacgtacgacggcgtgagggtgatg
gccgaggccttccagaaccttcggcggcagcgcatcgacatctcccgccgcggcaacgcc
ggcgactgcctggccaaccccgccgtgccctggggacagggcatcgacatccagagagcc
ctgcagcaggtccgttttgaaggattgtctggcaacgtccagttcaatgagaaaggacgc
aggaccaactacaccctccatgtgattgagatgaaacacgatgggatcagaaagattggt
tattggaatgaagacgagaagctggtcccaatagctgtagatactcaaagtggcaatgag
tctacaagcctgcagaacaggacctacatagtcacaactatcctggaggacccgtatgtg
atgctcaagaagaacgccaaccagtttgagggcaacgagaggtacgagggctactgcgtg
gagctggccgccgagattgccaagcacgtgggctaccactaccggctggagatcgtgcgc
gacggcaagtacggagcccgggaccccgacaccaaaacgtggaacggcatggtgggagag
ctcgtttatgggagggcagatgtggctgtggcaccattaaccatcaccctggttcgagaa
gaagttatagacttttccaagccattcatgagtttaggtatatcaataatgataaaaaaa
cctcaaaagtccaaaccaggagttttttcctttctggatcctttggcctacgagatatgg
atgtgcattgtttttgcctacattggagtgagcgttgtcctcttcctggtgagtcgcttc
agcccttatgagtggcacactgaggaatgcgaggaaggacgggaccagccagccaatgag
cagacaaatgagtttgggatattcaacagcctctggttctccctaggagctttcatgcag
caaggatgtgatatttctccaaggtctctctccggccgcatagtgggtggcgtctggtgg
ttcttcaccttgatcatcatctcctcctacacagctaacctggctgccttcctcaccgtg
gagaggatggtgtcacccattgagagcgcggaggacttggccaagcagacagaaatcgcc
tatggcaccctggaagctggctccactaaagaattttttaggcgatccaaaatagcagtg
tttgagaagatgtggacatacatgaagtcagccgagccctccgtttttgtgaggacaacg
gaagaggggatgatccgggtgaggaagtccaaagggaagtatgcctacctcttggagtcc
acaatgaacgagtacatcgagcagcgcaagccctgcgacaccatgaaggtgggaggtaac
ttggactccaaaggctatggcattgctacgccaaaggggtctgcgctgagaggtcccgta
aacctagcggttttgaaactcagtgagcaaggcgtcttagacaagctgaaaagcaaatgg
tggtacgataaaggggaatgtggaagcaaggactccggaagtaaggacaagacgagcgcg
ctgagcctcagcaatgtggcgggggttttctatatcctcatcggtgggctcggactcgcc
atgctggttgccttaatcgagttttgttacaagtccagaagtgaatcaaagcggatgaag
ggtttttgtttaatcccacagcaatcaatcaacgaagccatacggacatcaacccttccc
aggccggctgcagcaggaggcagtggagaaaatggacgtgtggtcagccacgatttcccc
aaatccatgcagacgatcccatgcatgagccacagcactggcatgtccctgggagctacg
ggattataa

DBGET integrated database retrieval system