KEGG   Lonchura striata domestica (Bengalese finch): 110483543
Entry
110483543         CDS       T05897                                 

Definition
(RefSeq) retinol dehydrogenase 5
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
lsr  Lonchura striata domestica (Bengalese finch)
Pathway
lsr00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:lsr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    110483543
Enzymes [BR:lsr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     110483543
SSDB
Motif
Pfam: adh_short adh_short_C2 KR NAD_binding_10
Other DBs
NCBI-GeneID: 110483543
NCBI-ProteinID: XP_021409195
Position
Unknown
AA seq 224 aa
MWLYLALLALAWALGWLLRDRRTLPTVSDKHVFITGCDSGFGNLLARRLARRGYRVLAAC
LTPQGAESLRGAPNLSTTLLDVTRTDSIRRAAEWVQSQVGXXGLFGLVNNAGVASPMGPT
EWMDMEDFRRVLAVNALGAIEVTLRLLPLLKRARGRVVNTSSVLGRVAANGGGYCPSKFC
IEAFSDSLRCVPAGGAERDGHSRRAPGYSRRAPGYSWVQSGYTW
NT seq 672 nt   +upstreamnt  +downstreamnt
atgtggctgtacctggcgctgctggccctggcctgggctctgggctggctgctgcgggac
cgccgcacgctgcccacggtgagcgacaagcacgtcttcatcacgggctgcgacagcggc
ttcggcaacctgctggcccggcggctcgcccggcgcggctaccgcgtgctggccgcctgc
ctgaccccgcagggcgccgagagcctccgcggggccccgaacctcagcaccaccctgctg
gatgtcacccggaccgacagcatccgccgcgccgccgagtgggtgcagagccaggtgggc
gnnncagggctgttcgggctggtgaacaacgccggcgtggccagccccatgggccccacg
gagtggatggacatggaggatttccgccgcgtcctggccgtcaacgcgctgggcgccatc
gaggtgacgctgcggctgctgccgctgctgaagcgcgcccggggccgcgtggtcaacacg
tccagcgtgctgggccgcgtggcggccaacggcggcggctactgcccctccaagttctgc
atcgaggccttctcggacagcctgcggtgcgtgcccgccggcggggctgagcgtgatggg
cacagccggagggcaccggggtacagccggagggcacctgggtacagctgggtacaatcc
gggtacacctgg

DBGET integrated database retrieval system