KEGG   Lonchura striata domestica (Bengalese finch): 110484086
Entry
110484086         CDS       T05897                                 

Gene name
AKAP5
Definition
(RefSeq) A-kinase anchor protein 5 isoform X1
  KO
K16522  A-kinase anchor protein 5
Organism
lsr  Lonchura striata domestica (Bengalese finch)
Brite
KEGG Orthology (KO) [BR:lsr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lsr01009]
    110484086 (AKAP5)
Protein phosphatases and associated proteins [BR:lsr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     110484086 (AKAP5)
SSDB
Motif
Pfam: Plasmodium_HRP
Other DBs
NCBI-GeneID: 110484086
NCBI-ProteinID: XP_021410158
Position
5
AA seq 810 aa
MVKAAKEIEMENPREAETPSTGATCSPPEEQTKKPSMLCFKKRKKSGKKGLAGKDVCEGA
SEEKSQCVSADQEEVKASNPSRSSKGTWAAIKSLARPQRRQKSSSRKKVPSDSQVQLEVD
AEESCAQDLPKKRASSGVKMPCVRFSRGRKKPSPSEAVEESEGSVQANEVMGIVNKASEE
PEDLAPTGKSESFSPVSAQEEQDTVKQEQLKEDQDTTKKDQDTMKEDQDSVKEDNHTAKE
SDTSVGKSEPLTQPAREAEEEHSECTVQLEITISETANETAQDKLQEGSLPQTTNDVEGR
EVASEAPVSKDQPDNAPEITEWQEIPNTCKEVPERDELEKSINLSKECKAEETVTGFSEL
VSGGDAASVQDAGSVQDAGSVQDAGSVQDAGSSKDAVSMQDAGSSKDAVSMQDAVSVKDA
ESVQDAARVQDAASVQDAVSVKDAESVQDAARVQDAASVQDAVSVQDVVSVQDVVSVQDA
ESVKDAASVQDAASVQDAESVKDAGSVQDAGSVKDAGSVQDAASVQDAGSVKDAGSVQDA
TSEQDEGRVKDAGSVQDATSVQDAVSVQDAMKEQDAASMKDAVCVQEAASVQEAVSVKDA
ESVQDAENAQEAASAQEAASVQEAVSVEDTASMQNATSVQEAVSVQEIVSAQDAAGMKEA
VSVQEAASVEDAASVQEAAGVQECSSHQILEANAGTGVSIIITITEAEDSDNTDSDQAYE
PSPVLHQKKQKGNKKSNRNADVGQKEGPEAGGGPQAEEKGLGDQGHRTGEQYELLLIETA
SSLVKAAIQSSIEQLVNEMALEQNKHNSFL
NT seq 2433 nt   +upstreamnt  +downstreamnt
atggtgaaggcagctaaggaaattgaaatggagaacccaagagaggcagagactcccagc
acaggagccacatgttcccctccagaggaacaaacaaaaaaaccctccatgctctgcttt
aagaagaggaagaagtctggtaagaaggggctggctgggaaggatgtgtgcgaaggagcc
tcagaggagaaaagccagtgtgttagcgctgaccaagaggaggtgaaagcttccaatcca
tcacggtcctccaaaggaacctgggcagccatcaaaagccttgccagacctcagagaagg
cagaagtcctcctcgcggaagaaggtgccctctgattcccaagtgcagctggaggtggat
gctgaggagagctgtgcccaggacctcccaaagaaacgggcaagctctggggtcaagatg
ccctgtgtgaggttctccagaggtaggaaaaaacccagcccctcagaagcagtggaggag
tcagagggcagtgttcaagcaaatgaagtgatgggtattgtgaataaggccagtgaagag
ccggaggatttggccccgacaggcaaatctgaatccttcagcccagtctctgcacaggag
gagcaggatacggtgaagcaggagcagcttaaagaggaccaggatacaacgaagaaggac
caagatacaatgaaagaggaccaggattcagtgaaagaggacaaccatacagccaaggaa
agtgacacctctgttgggaagagtgagcccttgacacagcccgcacgtgaggcagaagaa
gaacactcggagtgcactgttcagctggagataaccatttcagagacagctaatgaaaca
gcccaggacaaactgcaggaagggagtctgccccaaaccaccaacgatgtggagggcagg
gaagttgcttccgaagcgcctgtttctaaagatcaacctgataatgcccctgaaatcaca
gagtggcaggaaatccctaatacctgcaaagaggtgcctgaaagggatgaactggaaaag
agcataaatctttctaaggagtgcaaagccgaggagactgtaactggtttcagtgagctg
gtatctggaggtgatgcagcgagtgtgcaggatgcagggagtgtgcaggatgcagggagt
gtgcaggatgcagggagtgtgcaggatgcagggagttcaaaggatgcagtgagcatgcag
gatgcagggagttcaaaggatgcagtgagcatgcaggatgctgtgagtgtgaaggatgca
gagagtgtgcaggatgcagcgagagtgcaggatgctgcaagtgtgcaggatgcagtgagt
gtgaaggatgcagagagtgtgcaggatgcagcgagagtgcaggatgctgcaagtgtgcag
gatgcagtgagtgtgcaggatgtagtgagtgtgcaggatgtagtgagtgtacaggatgca
gagagtgtgaaggatgcagcaagtgtacaggatgcagcaagtgtacaggatgcagagagt
gtgaaggatgcagggagtgtacaggatgcagggagtgtgaaggatgcaggaagtgtgcag
gatgcagcaagtgtacaggatgcagggagtgtgaaggatgcagggagtgtacaggatgcc
acaagtgaacaggatgaagggagagtgaaggatgcagggagtgtacaggatgccacaagt
gtacaggatgcagtgagtgtgcaggatgccatgaaggagcaggatgcagcaagcatgaag
gatgcagtgtgtgtgcaggaggcagcgagtgtgcaggaggcagtgagtgtgaaggatgca
gagagtgtacaggatgcagagaatgcacaggaggcagcaagtgcgcaggaagcagcaagt
gtgcaggaagcagtgagtgtggaagatacagcaagcatgcagaatgccacaagtgtgcag
gaggcagtgagtgtgcaggagatagtgagtgcccaggatgcagcaggtatgaaggaggca
gtgagtgtgcaggaggcagcaagtgtggaggatgcggcaagtgtgcaagaggcagcaggt
gtgcaggaatgctccagccatcagatactagaagcaaatgcaggcactggtgtcagcatc
atcatcaccatcaccgaagccgaggactctgacaacaccgactctgaccaggcctatgag
ccgtccccggttttgcaccaaaaaaagcaaaaagggaataaaaaatcgaacaggaatgct
gatgttggtcaaaaagagggccccgaggctggtggcggtccccaggcagaggagaaaggt
ctgggtgaccaggggcacagaactggggagcagtacgagttgctcctcatagaaaccgcc
tcttcccttgtgaaggcggccattcagtcatccatagagcagctggtcaacgaaatggcc
ctggaacagaataaacacaacagctttctgtga

DBGET integrated database retrieval system