KEGG   Lonchura striata domestica (Bengalese finch): 116184685
Entry
116184685         CDS       T05897                                 

Definition
(RefSeq) delta(14)-sterol reductase TM7SF2-like
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
lsr  Lonchura striata domestica (Bengalese finch)
Pathway
lsr00100  Steroid biosynthesis
lsr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lsr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    116184685
Enzymes [BR:lsr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     116184685
SSDB
Motif
Pfam: ERG4_ERG24
Other DBs
NCBI-GeneID: 116184685
NCBI-ProteinID: XP_031363440
Position
Unknown
AA seq 263 aa
MGAEPGSPLEPPESLHWERVGLCAWLLVLAAALGEQQRLWGSPSLPLVLVAAAQGVPVLR
RLRELSRNSPPSPGGFLGLFGALAWGPFGGPLPALLLLRRPQNRLGGAGGAACGGLYALG
LWIFHGATTQRSLFSHDPRDPRVAGETPKPWTPKPLRIPKSGTPETPISLPGLPTVPTAT
GQVLLAGGWWGLVRRPDDLGELLMALGWTLPCGLSPPLLLLLAGAVLRELRALVGERRQR
RRFGGAWGGLCQRVPHRLLPLVY
NT seq 792 nt   +upstreamnt  +downstreamnt
atgggggcagaaccggggtccccgctggagccccccgagagtctgcactgggagcgggtc
gggctctgcgcctggctgctggtgctggcggcagctctgggggagcagcagcggctctgg
gggtccccgtcgctgcccctcgtgctcgtggcggccgctcagggggtcccggtgctgcgg
cgcctcagggagctgagcaggaattccccccccagccccgggggcttcctgggactcttc
ggggctctggcctggggcccttttgggggtcccctcccggcactgctgctcctgcgaaga
ccccaaaacaggctggggggagccgggggggctgcctgtggggggctctacgccctgggg
ctgtggatcttccacggtgccaccacccagaggagcctcttcagccatgacccccgagac
cctcgagtggccggtgagacccccaagccctggacacccaaaccgctgaggatccccaaa
tctgggaccccagagactcccatttccctcccaggtctccccacagtccccacggccaca
gggcaggtgctgctggcagggggctggtgggggctcgtgcgacgccccgatgacctcggg
gagctgctgatggccttgggctggaccctcccctgcgggctgtccccgccgctgctgctg
ctgctggcgggggccgtgctccgcgagctccgagcactcgtgggggagcggcggcagcgg
cgccgctttgggggggcctgggggggcctgtgccagcgtgtcccccaccggctgctgccc
ctcgtctactga

DBGET integrated database retrieval system