KEGG   Leptospira santarosai: LSS_12479Help
Entry
LSS_12479         CDS       T03999                                 

Definition
(GenBank) ADP-L-glycero-D-manno-heptose-6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
lst  Leptospira santarosai
Pathway
lst00540  Lipopolysaccharide biosynthesis
lst01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lst00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    LSS_12479
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:lst01005]
    LSS_12479
Enzymes [BR:lst01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     LSS_12479
Lipopolysaccharide biosynthesis proteins [BR:lst01005]
 Unusual sugar
  LSS_12479
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind Polysacc_synt_2 ThiF PS_pyruv_trans NAD_binding_10 KR
Motif
Other DBs
NCBI-ProteinID: EKT86391
UniProt: K8XZY5
Position
I:1810046..1811017
Genome map
AA seq 323 aa AA seqDB search
MAKKKCIVTGGAGLIGSNLIQELNRQGIEDILVVDHLGISSKWKNLVGKKYSDYLEKGNF
LDSAVRSSLLKDYDVLFHLGACSSTTETDASYLIENNFEYTKLLANESLKNGIRFVYASS
AATYGDGTHGYDDKTSIDALKPLNMYGYSKHMFDLYAQKRGFLNKITGIKYFNVFGYGEG
HKEDMRSVVLKGYEQIKKEGKIRLFKSYKSEYKDGEQKRDFLYVKDAAKITVYLAFGDYG
GLYNLGRGIAETWNDLVSAIFDTLKLPKNIEYIEMPETLKAKYQYYTCADTTKLLKTGYS
GGFTQLKEAVSEYVTLLQEEEGT
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggccaaaaaaaaatgtatcgttaccggcggggccggactcatcggatccaatctcatt
caggaactcaatcgacagggaattgaggatattctcgtggtggatcatttaggaatctcc
tccaaatggaaaaatctggtcggaaaaaagtattccgactatttggaaaagggaaatttt
ttggattcggcggttcgttcttctttattaaaagattatgatgttttatttcacttggga
gcttgttcctccacgaccgaaacggacgcttcctatctgatcgaaaacaatttcgaatat
acgaaacttctcgcaaacgaatctctaaagaacggaattcgattcgtatacgcttcctcg
gccgcgacgtacggagacgggacgcacgggtacgacgacaaaacctccatagatgctctc
aaacccttgaatatgtacggatattcgaaacacatgttcgatttatacgctcaaaaacgc
ggttttttaaacaaaattacaggaatcaaatacttcaacgtgttcggatacggagaaggg
cataaagaagatatgagaagcgtcgttctcaagggatacgaacaaatcaaaaaggaaggg
aagatccgtctttttaaatcctataaatccgaatacaaagacggagaacaaaaaagggat
tttttatacgtaaaagacgccgcaaaaattaccgtctatttggcgtttggcgattacgga
ggattgtacaatctcggaagaggaatcgccgaaacgtggaacgatttggtctccgcaatt
tttgatactttaaaacttcctaagaatatagaatatatcgaaatgcctgagaccctaaag
gcgaaataccaatattacacttgcgccgatacgacgaaacttttaaagacgggatattcg
ggagggtttacccagttgaaggaagctgttagcgaatatgtaaccctcctccaagaggag
gagggcacataa

DBGET integrated database retrieval system