KEGG   Leuconostoc mesenteroides subsp. suionicum: A6B45_01610Help
Entry
A6B45_01610       CDS       T05489                                 

Definition
(GenBank) hydroxymethylglutaryl-CoA reductase
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
lsu  Leuconostoc mesenteroides subsp. suionicum
Pathway
lsu00900  Terpenoid backbone biosynthesis
lsu01110  Biosynthesis of secondary metabolites
lsu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lsu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A6B45_01610
Enzymes [BR:lsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     A6B45_01610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red
Motif
Other DBs
NCBI-ProteinID: API71433
UniProt: A0A2N9KBJ5
Position
287492..288697
Genome map
AA seq 401 aa AA seqDB search
MSKKFYELTPDERLLALNLKEDIRLSLSSRQSPVNAQMVENYISDFRMPMGVVHDILIDE
QHFSVPMAIEEPSVVAAANNGAKMLSNGVHVIMADTAMIGQMLLIGAAGVDEFIDLHRDE
IFAKAKQAKPSIYKRGGGLRDVRVRNISKTETSVDFIIDTKDAMGANIVNTILEAELPLF
EKFVPLGVILSNYATNQLVTVTGDVDFERIGGREVAQKIVALNHFSKNDPYRATTENKGL
FNGISAVVLATGNDWRAVEASGHAYASRDGQYRGLVTWTILNGKLHGELTLPISVGTVGG
AISAMPDAKQALSIIGDVNADTLRGVILSVGLAQNLAALKSIASGGIQRGHMRMQYRALA
MQVGAKTDEITAIVSRLISLSYVDASVAKKILMEIRNEPKN
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaaaattttatgaactaacacccgatgagcgtttactcgcattaaatttaaaa
gaagatatccgattatcattgtcaagtcgtcaaagcccagtcaacgctcagatggttgag
aattacattagtgattttcgtatgccaatgggcgttgttcatgacattttgattgatgaa
caacattttagtgtgccgatggctattgaagaaccaagtgtggttgcagcagctaataat
ggtgcaaaaatgttatctaatggagttcatgtcatcatggcggatactgctatgatcggc
caaatgctgctgattggtgctgctggtgtggatgaattcattgacttacatcgcgatgag
atttttgctaaggcaaagcaagccaaaccatcgatttataaacgaggtggtggtttgcgt
gatgttcgagtaagaaatatctcgaaaacggaaacgagtgttgactttattatcgacaca
aaagacgcaatgggtgctaatattgttaatacaattttagaagcagaattaccattgttt
gaaaagttcgtacctttaggtgtgattttatctaactatgcgactaatcaattggtcaca
gtgactggtgatgtcgattttgagcgcataggtgggcgtgaagtagctcagaaaatagtc
gcattaaaccatttttccaaaaacgatccttaccgtgcaactacggagaataaaggtctt
tttaatggtataagtgctgtggttttggcgacgggtaatgattggcgagctgtagaagct
agtggtcatgcctatgcaagtcgtgatggtcaataccgtggtttagtaacttggacaatt
ttaaacggtaaacttcatggtgaactgacgttgcctatatctgttggcacggttggtggt
gcgatttcggctatgccagatgctaagcaggccttgtcaatcataggtgatgtgaatgca
gacacacttcgtggtgtaattttatctgttgggctggcgcaaaatttagcagccttaaaa
tcaattgcttcaggtggcattcaacggggacacatgcgaatgcagtatcgcgcgttagcg
atgcaagtaggcgcaaaaactgatgaaattaccgcaatagtatcacggttaatatccctc
agttatgtggatgcaagtgttgccaaaaaaatattaatggagataagaaatgaacccaaa
aattaa

DBGET integrated database retrieval system