KEGG   Leuconostoc mesenteroides subsp. suionicum: A6B45_07480Help
Entry
A6B45_07480       CDS       T05489                                 

Definition
(GenBank) nucleoside-diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
lsu  Leuconostoc mesenteroides subsp. suionicum
Pathway
lsu00230  Purine metabolism
lsu00240  Pyrimidine metabolism
lsu01100  Metabolic pathways
lsu01110  Biosynthesis of secondary metabolites
Module
lsu_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
lsu_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
lsu_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:lsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    A6B45_07480
   00240 Pyrimidine metabolism
    A6B45_07480
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lsu04131]
    A6B45_07480
Enzymes [BR:lsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     A6B45_07480
Membrane trafficking [BR:lsu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    A6B45_07480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: API72525
UniProt: A0A2N9K6M9
Position
complement(1528924..1529337)
Genome map
AA seq 137 aa AA seqDB search
MVERTFMMIKPDGVSRGKIGEIIQRIEHKGYAIKAMKMVQPTPELLAKHYAEHVGKSFYP
SLVQYMTSGPVIAMIGEGTNIVSGWRTIMGTTNPTLAAPGTIRGDLGREWEGEAVMNIVH
GSDSVEAAEYEIKLWFA
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atggtagaacgtacttttatgatgatcaaaccagatggcgtttcgcgtggtaaaattggt
gagattattcagcgaattgagcataaaggctatgcgattaaagcgatgaaaatggtacaa
cctactcctgaattactggcaaagcattatgctgaacatgtaggtaaatcattttatcct
tcgttagtgcagtatatgacttcgggaccggttattgcgatgattggagaagggaccaac
attgtatcagggtggcgaacaattatgggaacgaccaatcccacactagctgcaccggga
accattcgtggtgatttaggtcgtgaatgggaaggggaggctgttatgaatatcgttcat
ggttcggacagtgttgaagcggccgaatatgaaatcaaattatggtttgcgtaa

DBGET integrated database retrieval system