KEGG   Lactuca sativa (garden lettuce): 111878707Help
Entry
111878707         CDS       T05352                                 

Definition
(RefSeq) heat shock 70 kDa protein 3-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
lsv  Lactuca sativa (garden lettuce)
Pathway
lsv03040  Spliceosome
lsv04141  Protein processing in endoplasmic reticulum
lsv04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:lsv00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    111878707
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    111878707
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111878707
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lsv01009]
    111878707
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:lsv03041]
    111878707
   03009 Ribosome biogenesis [BR:lsv03009]
    111878707
   03110 Chaperones and folding catalysts [BR:lsv03110]
    111878707
   04131 Membrane trafficking [BR:lsv04131]
    111878707
   03051 Proteasome [BR:lsv03051]
    111878707
   03029 Mitochondrial biogenesis [BR:lsv03029]
    111878707
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lsv04147]
    111878707
Protein phosphatases and associated proteins [BR:lsv01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     111878707
Spliceosome [BR:lsv03041]
 Complex B
  Other components
   Prp19 complex
    111878707
 Complex C
   Prp19-CDC5 complex
    111878707
Ribosome biogenesis [BR:lsv03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    111878707
Chaperones and folding catalysts [BR:lsv03110]
 Heat shock proteins
  HSP70 / DNAK
   111878707
Membrane trafficking [BR:lsv04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    111878707
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    111878707
Proteasome [BR:lsv03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    111878707
Mitochondrial biogenesis [BR:lsv03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    111878707
Exosome [BR:lsv04147]
 Exosomal proteins
  Proteins found in most exosomes
   111878707
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl DDR DUF4656 Raco_middle FGGY_C RPW8
Motif
Other DBs
NCBI-GeneID: 111878707
NCBI-ProteinID: XP_023730982
Position
Unknown
AA seq 617 aa AA seqDB search
MNRKSCTAIGIDLGTTYSCVGVWQNDQVEIISNDQGNRTMPSCVAFTNGGRLIGEGAKNQ
IAMNTTNTIYDAKRLIGRRFNDTKLQEDMKLWPFDVIKGSNNIPMIVVTYNGEKKEFSAE
EISSMVLIKLKEAAEKFLGKTVRDAVITVPAYFDDSQRQATKDAGHVAGLNVLQIINEPT
SAAIAYGLDMKNDIVRDINVLIFDLGGGTFDVSLVTIDKKGTITVKAVAGDTHLGGQDFD
NAMVDYFVEELKRKHSIDVSVNKKALSRLRGACERAKRVLSSIIDTTIDIESLQDGVDFS
MRISRAKFEKLNEDFFSKCIEMVEKCLSDAEMNKRNIDEVVLVGGSTRIPKVQQLLKDLF
QGKELSKKIHADEAVAYGATVLAAKLTGCTGKKVDNLVLIDVVPLSLGVAIHDGSLSVIV
KRNSSIPAKKEINYCTVYDNQDSITFNVYQGERSRAIDNNWLGKFEVAVPCAPKGKSKVR
VVFDIDANGILNCSGVELTTGLKRGIIITNYKERLSTRNIEKMLDDAHKYKLQDEEYKKT
TSVRSALEDYIYDVKSKIKKIGKTTKTFNKKDLEIMETAIEKASEILKESPLADFDEYQK
ALNQLEKVCLPIIAQHV
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgaatagaaaaagttgtacggctattggtattgatcttggaacaacatattcttgtgtg
ggtgtttggcaaaatgatcaagttgagatcatatccaacgatcaaggaaataggactatg
ccatcttgtgttgctttcacaaatggaggacgtctaataggtgaaggtgctaagaaccag
attgctatgaacaccaccaacactatttatgatgcaaaaagattgattggaaggagattc
aatgataccaaacttcaggaagacatgaagttatggcctttcgatgtcataaaaggaagt
aacaacattccaatgattgtagttacttacaatggtgagaagaaggagttttcggcggag
gaaatttcatccatggttcttattaaattgaaagaagctgcagagaaattccttggtaaa
actgtacgtgatgcagtcatcacggtaccagcttattttgatgattcccaacgccaagca
acaaaggatgctggtcacgttgctggacttaatgttctacagattatcaatgagccaacc
tcagcagcaattgcatatggattagatatgaagaatgatatagttcgtgacataaatgtg
ctcatctttgatttaggtggtggtacatttgatgtatctcttgtcaccattgacaagaag
ggtacgataacagttaaggctgttgccggtgacactcacttaggcggccaggacttcgat
aacgcaatggttgactattttgtggaagaattaaagagaaagcatagtatagacgtcagt
gtgaataaaaaagcactatctcggttgaggggagcttgtgaaagagcgaaaagagttctc
tcttcaattattgatactactatcgatatcgaaagcttgcaagatggtgttgatttttct
atgagaatatctcgtgcaaagtttgaaaagcttaatgaagacttctttagtaagtgtata
gagatggtagagaagtgtctgagtgatgcagaaatgaataaaaggaacatagatgaagta
gtattagttggtgggtcaactaggatacccaaggtacaacaattgttgaaagacctcttc
caaggaaaagagctttctaagaagatccatgctgatgaggctgttgcatatggtgcaact
gttcttgctgcaaaattaacaggctgcactggtaaaaaagttgacaacttagtgttgata
gatgttgtacctctttcacttggtgtagcaatccatgatggctccttatctgttatagtt
aaaagaaattcctcaatacctgccaagaaggaaataaattattgtacagtttatgataac
caagatagtataactttcaatgtctatcaaggtgagagaagtagggctatagacaataat
tggttgggaaaatttgaagtcgcagtaccatgtgcaccaaagggcaagtcaaaggtaaga
gtcgtctttgacattgatgctaatggtattttaaattgctcgggagtggaattaactact
ggcctaaaaagagggattataattaccaattacaaggagagactttcaacgcgaaatata
gaaaaaatgctagatgatgctcataagtacaaattacaagacgaggagtacaagaagacg
acttctgtacgtagtgcactagaggactacatttacgatgtgaaaagcaaaatcaagaaa
attggaaaaactactaagacgtttaataagaaagacctagaaataatggaaactgccata
gaaaaagcaagcgaaattcttaaagaaagcccgcttgcggattttgatgagtatcaaaag
gcgctaaatcagttggaaaaggtatgtctgccaatcattgcccagcatgtttaa

DBGET integrated database retrieval system