KEGG   Lactuca sativa (garden lettuce): 111878897Help
Entry
111878897         CDS       T05352                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1 isoform X1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
lsv  Lactuca sativa (garden lettuce)
Pathway
lsv00010  Glycolysis / Gluconeogenesis
lsv00562  Inositol phosphate metabolism
lsv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lsv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111878897
   00562 Inositol phosphate metabolism
    111878897
Enzymes [BR:lsv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     111878897
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     111878897
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 111878897
NCBI-ProteinID: XP_023731145
Position
Unknown
AA seq 499 aa AA seqDB search
MAMVAKIGLILLFLYRIQFSSSAEQPFDVRQHLATVTRYGVSKDMKENPFVSSNIPDQCS
PIHLNLVARHGTRAPTKKRMKDLENFSAQLKSLLKDAKERGASLEKLPSWLWEWRSPWKG
KTKGGELISQGEDEMYNLGIRIRERFQELFSDEYHHDVYQIRASQIPRASASAVSFGMGM
FSGRGELGVGKHRAFAVLSESRASDIMLRFHDCCKNYKAYRKQQEPAVDKLKEPVLEEIT
HSLAARYGLNFTIKDTTTLWFLCKQEASLLDITDQACGLFTNDEVSLLEWTDDLEMFIVK
GYGNALNYRMGVPLLQDVILSMEQAIKAKEEGYAPGSYEKATLRFAHAETLVPFSCLIGL
FLEGSEFEQIQREEPLKYPPKPPERRTWRGSRVAPFAGNNVLVLYSCSRNNTNKYFMQVL
HNEQPIPMAGCGGTDFCPFEVFKEKIAAPHLKHNYDELCNAKVQEPECKSYTTKITEMLG
SIFSGKTNNDETSSQKEEL
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggcgatggtggcgaagataggcctcatactactgtttttatatcgtattcaatttagt
tcctccgctgaacaaccgtttgacgttcgtcaacacctggctaccgtaacacgatatggg
gtttcaaaagacatgaaagaaaatccgtttgtttcatcaaacatccctgatcaatgttct
cctatccacctaaatcttgtggcaaggcacgggacacgtgcacctaccaagaaaaggatg
aaagacctggaaaatttttcagctcaactgaaatctcttttgaaagacgcaaaagaaaga
ggggcatctttggaaaaacttccttcctggttgtgggaatggaggtctccatggaagggg
aaaaccaaaggtggagaactaataagtcaaggagaagatgaaatgtataaccttggaatc
agaatcagggaacggtttcaagaactgtttagtgatgaatatcaccatgatgtatatcag
atcagagcatcccagattcccagagcttcagctagtgctgtttcatttggaatgggcatg
tttagtgggagaggagaacttggagtaggaaagcatcgagcttttgcagttttgagtgaa
agtcgtgcaagtgatataatgttgagattccatgattgttgtaagaactacaaggcttat
aggaaacaacaggaacctgctgttgataagcttaaagaacctgttttagaagagataaca
cattcattagcagcacgttatgggcttaatttcacaatcaaagataccaccacactttgg
tttttatgcaagcaggaagcatccttgttagacataactgatcaagcttgtggtcttttc
actaatgatgaggtgagtctattagagtggacagatgatctggaaatgttcatagtaaag
ggttatggaaatgcattaaattatcgaatgggagtgccattgctgcaagatgtaatattg
tccatggagcaggcgattaaagcaaaagaagaagggtatgcaccagggagttatgaaaag
gcaacgttaaggtttgcacatgcagagacattggttcctttttcatgtttgattggactc
tttcttgaaggatctgagtttgaacaaatacaaagagaagagccgttgaaataccccccg
aaacccccagagagaagaacatggaggggaagcagagtggctccttttgctgggaataat
gttttagttttatacagctgttcccgaaataacacaaataaatatttcatgcaagtttta
cacaatgaacaaccaatcccaatggctggatgcgggggtactgatttctgtccatttgaa
gttttcaaggagaaaatagcggcgccacatttgaagcacaattatgatgagctatgcaac
gcgaaggtgcaagagccggaatgcaagtcatatacgactaaaataaccgaaatgttgggt
tcgattttctcaggaaaaaccaacaacgatgaaacatcatcacagaaagaagaactataa

DBGET integrated database retrieval system