KEGG   Lactuca sativa (garden lettuce): 111879071Help
Entry
111879071         CDS       T05352                                 

Definition
(RefSeq) erlin-2-B
  KO
K23341  erlin
Organism
lsv  Lactuca sativa (garden lettuce)
Brite
KEGG Orthology (KO) [BR:lsv00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:lsv04121]
    111879071
Ubiquitin system [BR:lsv04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ERAD complex
    111879071
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Band_7
Motif
Other DBs
NCBI-GeneID: 111879071
NCBI-ProteinID: XP_023731316
Position
Unknown
AA seq 367 aa AA seqDB search
MDTGTQPRPQPQPPRRPPTEPLRQQGNGDFTAIVTVLFAFIAIASLVLIPSSSPNLKNSL
TVLHQVPEGHVGVYWLGGALQKTTTTPGFHLKLPIITHYEPVQVTLQTDLVRDIPCGTKG
GVMINFDRIEVVNRLKKESVYDTLLNYGVEYDHTWIYDKIHHEINQFCSVHSLQEVYIDM
FDQIDETMKDALQADCTRYAPGIEIISVRVTKPRIPESVRRNFEQMEEERTKVLVSVERQ
RVAEKEAETQKKIAISEAEKNAHVSKIIMEQKLMEKDSLRLQEEISNRMYLAREKSLADA
KYYQTMREAEANKLKLTPQFLELKFIEAITNNSKMFFGNKIPNMVLGQRLLGNFLQEVEG
RTNLEAA
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggacaccggaacgcaaccgaggccgcaaccacaaccgccacgccgaccgccgacggaa
ccacttcgtcaacaaggaaatggcgatttcacggcaattgtcaccgttctatttgccttc
attgctattgcctcccttgttttgattccatcttcatcaccaaacttgaagaacagctta
acagtcttgcatcaagttcctgaaggtcatgttggggtttactggctagggggtgccctt
caaaagacaactacaactccaggttttcacctgaagttacctatcattacccattacgag
cctgtccaggtcacccttcagacagatctggtgagagacattccttgtgggacaaaaggg
ggtgttatgataaactttgacaggatagaggttgttaatcgcctgaaaaaggaatctgtg
tatgacacccttctcaactatggtgtagagtatgaccatacttggatatatgacaaaatt
catcatgaaatcaatcaattctgcagtgttcactcccttcaagaagtttacattgacatg
tttgaccagattgatgaaacaatgaaagatgctcttcaagctgattgtacgcgttatgca
ccaggcatagagattatcagtgttcgtgtcacaaagcctagaattccagaaagtgtaagg
agaaactttgagcagatggaagaagaacgcaccaaggtgttggtatcggtagaaaggcag
agggttgctgagaaagaggcggaaacacaaaagaagattgctatttcggaagctgagaag
aatgctcatgttagcaagattataatggaacagaaattaatggaaaaagatagtttgagg
ctgcaagaagaaatttcaaatagaatgtatcttgcccgagaaaagagtttggctgatgcc
aaatattatcagactatgagagaagctgaagcaaataagctgaagcttacaccccaattc
ttggagcttaaattcattgaggcaatcactaataactctaaaatgttctttggaaacaag
ataccgaatatggtgttgggtcaaaggttgcttgggaacttcttgcaagaggtggaagga
agaaccaatttggaagcagcatag

DBGET integrated database retrieval system