KEGG   Lactuca sativa (garden lettuce): 111879994Help
Entry
111879994         CDS       T05352                                 

Definition
(RefSeq) non-specific phospholipase C3-like
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
lsv  Lactuca sativa (garden lettuce)
Pathway
lsv00562  Inositol phosphate metabolism
lsv00564  Glycerophospholipid metabolism
lsv00565  Ether lipid metabolism
lsv01100  Metabolic pathways
lsv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lsv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    111879994
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    111879994
   00565 Ether lipid metabolism
    111879994
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:lsv02042]
    111879994
Enzymes [BR:lsv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     111879994
Bacterial toxins [BR:lsv02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   111879994
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phosphoesterase
Motif
Other DBs
NCBI-GeneID: 111879994
NCBI-ProteinID: XP_023732178
Position
Unknown
AA seq 510 aa AA seqDB search
MASPIKTVVVLVQENRSFDHMLGWMKSMNPEIDGVTGKESNLLSTTNHHSQRLYHTNKAG
FIQPDPGHSFEATYEQIFGVEWSESSTPGLTPTMDGFAQQAEKVQPGLSEVVMTGFDPDS
LPVYKELVSEFAVCDRWFSSIPTLTQPNRLYVHSATSYGATINDTEMMIKGYPQKTIFES
VEDGGHSFGIYYQLPPSTLFYRNLRKLKYIDNFHQFDLHFKRHCKEGKLPNYVVVEQRYF
GIKGLPGNDDHPSHDVSDGQKFVKEVYEALRSSPQWNEILFVIVYDEHGGFYDHVPTPNV
GIPNPDGLIGPSPYNFQFDRLGVRVPAILVSPWIERGTVLHKPTGPYPTSEFEHSSIPAT
VKKIFGLKSHLTKRDEWAGTFEGVARRTTPRTDCPVTLPDPMKMREFEPDENEKLSEFQQ
ELVQLGAVLNGDHKRDMFPSKLVENMTVTEGAKYLEDAYKKFCEDCEQAKRDGKDESHIV
CLEEEPTPESPKKSSRSFSQKLFSCLVCEH
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggcatccccaataaaaacagtggttgttcttgttcaagaaaatcgatcttttgatcac
atgcttggatggatgaaatccatgaaccctgaaattgatggagtcaccggaaaagaatcc
aaccttttgtccaccaccaaccaccattcccaacgcctctaccacaccaacaaggccggg
ttcatccaacctgaccctggtcactctttcgaagctacatacgaacaaatctttggtgtt
gaatggtccgaatcatcaactcctggtctaaccccgacaatggatgggttcgctcaacaa
gctgaaaaggtccaaccaggcttgtccgaagtggtcatgactgggttcgacccggattcc
ttacctgtttacaaagagttggtttcagagttcgctgtttgtgacagatggttttcatcg
attcccactttgacacaacctaacagattgtatgttcattctgcaacgtcatatggtgcg
actataaatgacaccgagatgatgatcaaagggtacccacaaaagaccatatttgagtct
gtggaggatggtggtcattcttttggaatttactatcagttacccccgtcaactcttttt
tacagaaacttaagaaaactgaaatacatagacaacttccatcaatttgatctacacttc
aagcgacattgcaaggaaggaaagctaccaaattatgtcgttgttgaacaaaggtatttt
gggatcaaaggtttgcctggaaacgatgatcacccatcacatgacgtgtccgatggtcaa
aagtttgtgaaagaagtctacgaagctttgagatcaagcccacaatggaacgaaatctta
tttgtaattgtgtacgatgaacatggaggtttttatgatcatgttccaacaccaaatgta
gggattccaaatcctgatggtttgatcggcccttcgccttataatttccagtttgatcga
cttggtgttagggttccagccattcttgtttctccatggatagaacgtgggacagtgtta
cataagccaacagggccatatcctacgtcggagtttgaacattcatctattccggcaact
gttaaaaagatttttggtctgaaatcacatctaacgaaaagggacgagtgggcgggtact
tttgaaggtgttgcacgcagaactaccccaagaaccgattgtccagttactttgccggat
cccatgaaaatgcgagagtttgagccagatgaaaacgaaaaacttagcgagtttcagcaa
gagttggtccaactaggtgctgttttaaatggagaccataaacgagacatgtttcctagc
aaattagtcgagaacatgactgtaacagaaggtgcaaagtatctggaagatgcatacaag
aagttctgcgaggattgtgaacaagccaaaagagatggtaaagatgagtctcacatcgtt
tgtttagaggaggaaccaactcctgagtctccaaagaaatcatcgaggtcattttctcaa
aagttgttttcttgtttagtttgtgaacattag

DBGET integrated database retrieval system