KEGG   Lactuca sativa (garden lettuce): 111881027Help
Entry
111881027         CDS       T05352                                 

Definition
(RefSeq) L-type lectin-domain containing receptor kinase IX.1-like
Organism
lsv  Lactuca sativa (garden lettuce)
SSDB OrthologParalogGFIT
Motif
Pfam: Lectin_legB Pkinase Pkinase_Tyr Bact_lectin Pkinase_fungal Lectin_leg-like CcmD Seadorna_VP7 Kinase-like APH
Motif
Other DBs
NCBI-GeneID: 111881027
NCBI-ProteinID: XP_023733190
Position
Unknown
AA seq 694 aa AA seqDB search
MAFSRSHVITYFLLVLIPYAASITFNLPDIGPENQNLDLRTEGDRAYISDTGIQVTPDGI
GSDRSEKAGRAIYLTPFHLWDNKSNELASFSTNFTFVIDSNRATAYGDGLTFFLAQNNSV
ICRGGGMGLPINGTTVVVTNPFVAVEFDTFSNVWDPVDSNNASIGDHVGISISSVISVSH
QKWFSNITGGRVCQAWVTYDSVSNNLSVSFTGFQNNTIIRQVGLVYTVDLRKVLPEWVIF
GFSAATGAQFQKNNVRSWSFSSSDLQVDENNRITPDIGPNPVKNSSRVGLVVGVSVGVTF
LAVLGFVLWRWKKKKSREDEHEDEESGFDMEMNNEFEMGTGPKRFSYQELARSTGEFSEN
EKLGEGGFGGVYRGFLKDSNTYIAVKRVSKSSKQGIKEYASEVKIISRLRHRNLVQLIGW
CHEKSELLLVYEFMENGSLDSHLFKAKTLLTWGTRNKIAHGLASALLYLHEEWEQCVLHR
DIKSSNLMLDSNFNAKLGDFGLAKLVDHEKGSQTTMLAGTLGYMAPECLVTGKATKESDV
FSFGVVALEIACGRKTIEYKAPENQIRLIQWVWELYGIGTLLEAVDPRLGLDFEEEEIKR
LMILGLWCVHPDSDFRPSMRQVVQVLNSEASVPILPSKMPVASYFTPPMSSLYGVTSIIQ
NQSSSGVFNTDSSKQTSSTASSSSPSVSLLHSIH
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atggcgttctccaggagccatgtaattacatacttccttctggttttgatcccttacgca
gcttcaataacctttaatttgccagatatcggtccagagaatcagaaccttgacttaaga
acagaaggcgaccgagcttatatctccgacaccggaattcaggtgaccccagatggaatt
ggttccgatcggagcgagaaagccggccgggccatatacctgacaccattccatctttgg
gacaacaaatctaacgagctggcaagcttctctaccaatttcaccttcgtgatagattca
aacagggccacagcctacggtgatggcctcaccttcttcctcgcacaaaataactcagtc
atatgtcgtggtggtggcatggggcttcccatcaatggcacaaccgttgttgtcacaaac
ccgtttgttgcagtggagtttgatactttttccaatgtttgggatccagtagactctaat
aatgcttcaataggtgatcatgtaggtatcagtattagttctgttatttctgtttcgcat
cagaaatggttcagcaatataactggtggaagagtctgtcaagcttgggttacatatgat
tctgtttcgaataatcttagtgtttcctttactggttttcaaaataatacaatcatacgt
caagtaggccttgtgtacacagttgatctcaggaaggtgttgccagaatgggttattttt
gggttttcagcagcaaccggagctcaattccagaaaaataatgtgagatcttggagtttc
agtagctctgatttacaggttgatgaaaacaaccggataactccagacataggcccaaac
ccagtgaaaaacagcagcagggtgggattagtagttggagtatcggttggagttactttt
ttggctgtgcttggttttgttttatggaggtggaagaagaagaaaagcagggaagatgaa
catgaagacgaagaatctggatttgatatggaaatgaacaatgaattcgaaatgggcacc
gggcctaaaagattctcttaccaagaattagctcgatctaccggtgagttttcagagaac
gagaagcttggtgaaggaggttttggtggggtttatagaggtttcttgaaagattccaac
acctatattgcagtgaaaagggtgtcaaagagttcaaaacaggggatcaaggagtatgcg
tcggaagtaaagatcattagccgattgaggcatagaaacctagtgcaactcataggttgg
tgccacgaaaaaagcgaactcctccttgtttacgagtttatggaaaacggaagcttagat
tcacatctctttaaggcaaaaaccttattgacatggggaacaaggaacaaaatcgcacat
ggtctggcttcagcgttgttatatctacatgaagaatgggaacaatgtgttttgcataga
gatatcaaatcgagtaacctgatgttggactcaaatttcaatgccaagcttggggatttt
gggttagccaagttggttgaccatgagaagggctcacagaccacaatgttggctggaacc
ttgggttacatggctccggaatgtttagtaaccggaaaggcaaccaaagaatcagatgtg
ttcagctttggagtcgttgcactggaaatagcttgtggccgaaaaacaatagagtacaag
gctccagagaatcaaataaggttaatccaatgggtttgggagctctatgggatagggaca
cttttagaagcagtggatccacgtctagggttagattttgaggaagaagaaataaagcgg
ttgatgatccttgggttatggtgtgtgcaccctgactcggattttcgtccatcgatgaga
caagtggttcaagtactgaactctgaagcttccgtacctatactcccctcaaagatgcca
gtggcatcttattttacccctcccatgtcttcattatatggtgtcacttccatcattcaa
aaccagtcatcaagtggtgtctttaacacggattcctcaaagcaaacttcatcaacagca
agttcttcttctccatctgtttcattgttacattctatacattga

DBGET integrated database retrieval system