KEGG   Lactuca sativa (garden lettuce): 111881520Help
Entry
111881520         CDS       T05352                                 

Definition
(RefSeq) succinate--CoA ligase [ADP-forming] subunit alpha, mitochondrial-like
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
lsv  Lactuca sativa (garden lettuce)
Pathway
lsv00020  Citrate cycle (TCA cycle)
lsv00640  Propanoate metabolism
lsv01100  Metabolic pathways
lsv01110  Biosynthesis of secondary metabolites
lsv01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lsv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    111881520
   00640 Propanoate metabolism
    111881520
Enzymes [BR:lsv01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     111881520
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     111881520
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding CoA_binding_2 Succ_CoA_lig Ligase_CoA
Motif
Other DBs
NCBI-GeneID: 111881520
NCBI-ProteinID: XP_023733676
Position
Unknown
AA seq 191 aa AA seqDB search
MDTSDLRRFTVEGTTSDIQVGGVTPKKGGTEHLGLPVFISVADEKSETKANASVIYVPPP
FAAATIMEALEVELDLIVCITEAIPQHDMVRVKAALIKQSKTRLIGPNCPGIIKPEECKT
RIMPGYIHKPGRIGIVSRSGTLTYEAVYQTTTVGLGQSARVGIGEDPFNMTKFVDCMRKF
VDDPQTEDCAA
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atggacacttcagatcttagaaggtttacagtggaaggtacgaccagtgacatccaggtt
ggtggagttaccccaaagaagggtggaacagagcatttagggctccctgttttcatctca
gttgcagatgaaaaatctgaaaccaaggctaatgcatctgtaatttatgtgcctccacca
tttgctgcagcaacaatcatggaagcattagaggttgaattggatttgattgtttgcatt
acagaagcaattccacaacatgacatggttcgtgtaaaggctgctcttattaagcagtca
aaaactcgactgattggaccaaattgtcctggtatcattaagcctgaagaatgcaaaacc
agaatcatgcctggttacattcataaaccagggcgtattggtattgtatctcgatctggc
acactaacttatgaagcggtataccaaactactactgtagggctaggtcaatccgcacgt
gtaggtattggtgaggatccttttaacatgaccaaatttgttgactgcatgagaaaattc
gttgatgaccctcagacagaagattgtgcagcttga

DBGET integrated database retrieval system