KEGG   Lactuca sativa (garden lettuce): 111881866Help
Entry
111881866         CDS       T05352                                 

Definition
(RefSeq) probable glycosyltransferase At3g42180
  KO
K18789  xylogalacturonan beta-1,3-xylosyltransferase [EC:2.4.2.41]
Organism
lsv  Lactuca sativa (garden lettuce)
Brite
KEGG Orthology (KO) [BR:lsv00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:lsv01003]
    111881866
Enzymes [BR:lsv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.41  xylogalacturonan beta-1,3-xylosyltransferase
     111881866
Glycosyltransferases [BR:lsv01003]
 Polysaccharide
  Structural polysaccharide
   111881866
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Exostosin Glycos_transf_1
Motif
Other DBs
NCBI-GeneID: 111881866
NCBI-ProteinID: XP_023734018
Position
Unknown
AA seq 441 aa AA seqDB search
MAAATKFLIILTILSLSVLVPDGSPINETQSALSLSSLQDDGESKVKENDITLARIEEQL
AKARGKIRNAIVKRSFTSSPKDRSLFPKRTVYKNPFAFFQSHTEMMKTFKIWTYKEGDAP
LMHDGPMKLVYSIEGDFIEEMEREGNPIVANHPDEAHAFFIPLSVTNIVHYLFTPEEAWG
FRERMQAILEDYIKVIAEKYPYWNRSNGADHFYVSCHDWGPVVSTGNPKLFKNFIRVLCN
ANSSEGFDPSRDVSMTESTAPFNNIPVVSSGHSPYNRSIFAFFAGGIHGDVRKRLFEHWG
NNEDKDIQVYNYLPKGENHTEWLSKSKYCLSPSGYEVATSRLTEAIYVGCVPVIIKKNYV
IPYNDVLDWSQFSVQVPVDDIPNLKKILQDIPFSKYLEMQKRLIEVQRHFAVNIPAKPFD
VFHMIFHSVWLRRLNVRLLKS
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggcggctgctaccaaattccttatcatattaactatactttcgctttctgttcttgta
ccggatggatctccaataaatgaaacccaaagtgctctttctttgtccagtttgcaagat
gatggtgaatccaaagtcaaagaaaatgacattacattggcaagaatcgaagaacagtta
gctaaggcaagaggcaaaatccgcaatgcaattgttaagaggagctttacatcgtctcct
aaagataggagtttattccccaaacgaaccgtctacaagaatccatttgccttttttcag
agtcatacggagatgatgaagacattcaagatatggacttataaggaaggagatgccccc
ttgatgcatgatggtccaatgaaacttgtatacagtatcgagggtgatttcatcgaggag
atggagagagaaggaaatccgatagtggctaaccatccagatgaagcacatgctttcttt
atccctttaagtgtaaccaacattgttcactacctttttacgcctgaggaagcctggggt
tttcgtgaacggatgcaagcaatactcgaagactacattaaggtgattgcagaaaagtat
ccttactggaaccgtagcaatggagctgatcacttctatgtatcatgtcatgattggggt
ccagttgtttcaacaggaaaccctaaactctttaagaatttcataagagtgctttgtaat
gccaacagctccgaaggttttgatccaagtcgtgatgtgtcgatgacagaaagtacagcg
ccattcaacaatatcccagtcgtaagtagtggccactcaccttataatcgttcaatcttc
gcattctttgcgggtggtatacatggtgatgtaagaaaacgtttgttcgaacattgggga
aacaatgaagataaagacattcaagtttacaattaccttccaaaaggagaaaatcacact
gaatggttgagcaaaagtaagtactgcttaagtcctagcggatatgaagttgcaacctct
aggttaacagaagcaatctatgtgggatgtgttccagtaatcatcaagaagaattacgtt
ataccatataatgatgtgttggattggagtcagttttcagtacaagtgcctgtagacgat
attccaaatctcaaaaagattttgcaagacatccctttttccaagtatttggaaatgcaa
aaaaggttaatcgaagtgcaaagacattttgcagttaatattccagctaaaccttttgat
gtctttcacatgatttttcattctgtatggcttagaagacttaatgttcgattgttgaaa
tcttga

DBGET integrated database retrieval system