KEGG   Lactuca sativa (garden lettuce): 111882413
Entry
111882413         CDS       T05352                                 

Definition
(RefSeq) germacrene A oxidase
  KO
K15800  germacrene A oxidase [EC:1.14.14.95]
Organism
lsv  Lactuca sativa (garden lettuce)
Pathway
lsv00909  Sesquiterpenoid and triterpenoid biosynthesis
lsv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lsv00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    111882413
Enzymes [BR:lsv01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.95  germacrene A hydroxylase
     111882413
SSDB
Motif
Pfam: p450 DUF1323
Other DBs
NCBI-GeneID: 111882413
NCBI-ProteinID: XP_023734551
Position
Unknown
AA seq 488 aa
MELSITTSIALATIVFFLYKLATRPKSTKKQLPEASRLPIIGHMHHLIGTMPHRGVMDLA
RKHGSLMHLQLGEVSTIVVSSPKWAKEILTTYDITFANRPETLTGEIIAYHNTDIVLAPY
GEYWRQLRKLCTLELLSVKKVKSFQSIREEECWNLVKEVKESGSGKPINLSESIFKMIAT
ILSRAAFGKGIKDQREFTEIVKEILRQTGGFDVADIFPSKKFLHHLSGKRARLTSIHKKL
DNLINNIVAEHHVSTSSKANETLLDVLLRLKDSAEFPLTADNVKAIILDMFGAGTDTSSA
TVEWAISELIRCPRAMEKVQAELRQALNGKEKIQEEDIQDLAYLNLVIRETLRLHPPLPL
VMPRECREPVNLAGYEIANKTKLIVNVFAINRDPEYWKDAEAFIPERFENNPNNIMGADY
EYLPFGAGRRMCPGAALGLANVQLPLANILYHFNWKLPNGASHDQLDMTESFGATVQRKT
ELLLVPSF
NT seq 1467 nt   +upstreamnt  +downstreamnt
atggagctttcaataaccacctccattgctctcgccaccatcgtcttcttcctttacaag
cttgccactcgtcccaaatccactaaaaagcaacttccagaggcatcgcgactccccata
atcggtcacatgcaccatctaatcggtacaatgccacatcgtggtgttatggatttagca
agaaagcatggatctttgatgcatctgcagcttggtgaggtctcgacaatcgtggtgtca
tctccaaaatgggctaaagagattttaacgacttacgacattaccttcgctaacaggcct
gagaccctaactggtgagatcattgcatatcacaacacagatatcgttcttgcaccctac
ggtgaatactggagacaactacgaaagctttgcactttggagcttttgagtgtgaagaaa
gttaagtcgtttcagtcaattcgtgaagaggagtgctggaatttggttaaagaagttaag
gagtcagggtcagggaaaccgatcaatctttcagagagtattttcaagatgatagcgact
atattgagtcgagcagcgtttggaaaaggaatcaaggatcaaagagagtttacagagatt
gttaaagagatcttgaggcaaactggtggttttgatgtggcggatatctttccttcgaag
aaattccttcatcatctttccggcaagagggctaggttaaccagtattcacaaaaagctt
gataatttgatcaacaacatcgtcgctgaacaccatgttagcacctcaagcaaagccaac
gagacacttctcgatgtgcttctacggcttaaagatagcgctgagttcccattaacagcc
gataacgttaaagccattattttggatatgttcggagctggaacagacacttcatccgcc
acagtagaatgggccatttccgaactgataaggtgtccgagagccatggagaaggtacaa
gcagaactaaggcaagcattgaacgggaaagaaaagatccaagaggaggacattcaagac
ctcgcatacctaaacctcgtgatccgagaaaccctccgcttacaccctccactaccattg
gttatgccacgagaatgccgtgagccagtgaacttagcaggttatgaaatagccaataag
accaaacttattgtcaatgtctttgcaatcaacagagaccctgaatactggaaagacgct
gaggctttcatccctgagaggtttgaaaacaaccctaataacatcatgggagcagattat
gagtatcttccatttggagctgggagaaggatgtgtcctggagctgcactagggttagct
aatgttcagcttccacttgcaaacatactttatcatttcaactggaaacttcctaatggt
gccagccatgaccaacttgatatgactgagagctttggagccacggttcaaaggaagact
gagttgttactcgtaccgagtttttag

DBGET integrated database retrieval system