KEGG   Lactuca sativa (garden lettuce): 111882685Help
Entry
111882685         CDS       T05352                                 

Definition
(RefSeq) wall-associated receptor kinase 2-like
Organism
lsv  Lactuca sativa (garden lettuce)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr GUB_WAK_bind cEGF WAK EGF_CA EGF EGF_3 APH
Motif
Other DBs
NCBI-GeneID: 111882685
NCBI-ProteinID: XP_023734819
Position
Unknown
AA seq 758 aa AA seqDB search
MLLLFILVLTWMSPLPEGNFVGATAIAKPGCLTKCGEVTVPYPFGINYVVMPGRNITQNC
ALEDTFELTCNLTSKAPELFIGRGNLKVYNISDTEMRISVSIAFRCYDSYGNISENRTSW
TDIPERFPLTFSQKNKFTLIGCDDYAWIRGPPGSDYASGCMGICNNPSRVPDNGTCSGSG
CCQTSIPQGLQYFNITLGSFNNHGSVVSSNRCGFAFLGEEESFKFGGARDMSNATEFYIK
TRSNVRRVLDWEIRDNPNILEPTVCKGNSLRKNVSISGYHCSCKEGYQGNPYLEPGCEDI
DECMDNSTYPCYGNCNNTPGDYTCTCLVGYEGDGKTKNGCQRKASKFPVIALSLALVFGL
LAIFSGISGIFLGVRKRKLIKLREKFFEQNGGEFMKQKLKATGANDAVTMFSTDQLRKAT
DNYSEERIVGRGGYGVVYKGFLPDNRVVAIKKSKIVDGSQSEQFINEIWILSQVIHRNVV
KLLGCCLEEEVPILVYEFISNNTLFYHIHHKPGGMSWLSWENRLRVAAEAASALAYLHSQ
ATMPIIHRDVKSANILLDENFTTKISDFGASRLVPLDHDQVTTLVQGTLGYLDPEYFHTS
QLTDKSDVYSFGMVLAELITGRLPICAARTNEEKNLATYFVKSMKENRLFQIVEPRLLQE
GTLEQLQTVAELVKRCLNLLGDERPTMKEVAMELEGLRKFTTHPWNQQHEQAPEESRSLI
LEVEQSDLYGVPLIPYSSNEWESYSGITEMAFQENKPR
NT seq 2277 nt NT seq  +upstreamnt  +downstreamnt
atgcttcttcttttcatccttgttctaacctggatgtcgccattacctgagggcaatttt
gtaggtgctacagctatagcaaagccaggttgcctaacaaaatgtggggaagtgacagtt
ccatacccttttggcatcaactacgtagtaatgccgggacgcaacataacgcaaaactgt
gccttagaagatacatttgagctgacctgcaacttgacttcaaaagctccagagcttttt
attgggagggggaacctcaaggtctacaatatttcagacacagagatgagaatttccgtt
tcaattgccttcagatgctacgacagttatgggaatataagtgagaatagaacttcctgg
actgacattccagagaggttccccctcacattttcccagaagaacaagttcactctcatc
ggatgcgatgattatgcatggataagagggccaccaggatccgactatgctagcggctgc
atggggatatgtaacaacccaagtcgtgtgcctgataatgggacatgctcaggaagtggg
tgttgtcagacatcaataccacagggtctccaatatttcaatattacacttggctctttc
aataaccatggcagtgtggtgtcctcaaatcgttgcggttttgcatttcttggtgaggaa
gagagctttaagtttggtggtgctcgtgatatgtctaatgctacagagttttatataaag
acaaggtccaatgtccgcagggttctggattgggaaattagagacaacccgaatatctta
gagcctacggtatgcaagggaaatagcctccgtaagaatgtcagtattagtgggtatcac
tgcagctgcaaggaaggttaccagggcaatccttatcttgaacccggctgcgaagacatc
gacgagtgcatggataatagtacatacccttgttatgggaattgcaataatactccaggg
gattacacctgtacttgtttagttggatacgagggtgatgggaaaactaaaaatgggtgt
caacgtaaagcttcaaagtttccagtgattgcattatctttagctctggtctttggctta
cttgccatattttctgggataagtgggattttccttggcgtaaggaagaggaaactcata
aagctacgagaaaagttttttgagcaaaatgggggtgagtttatgaaacaaaagctcaag
gcaacaggggctaatgacgctgtgactatgtttagcacagatcagcttcgaaaagcaact
gataactattctgaggagcgaattgttggccgaggtggttatggtgtagtgtataaagga
ttcttaccagataatcgtgttgtcgcaataaagaagtctaaaatagtggatgggagtcaa
tctgagcaattcatcaatgaaatctggatcctttcacaagttatccatcgaaatgtggtt
aagttgttaggctgttgtttggaagaggaggtaccaatactagtttatgagttcatatcc
aataacacgcttttctatcacattcatcataaacctggtggaatgagttggttatcatgg
gagaatcgattgagagttgctgctgaagctgcatctgcacttgcatatcttcattcacaa
gctactatgcctattatacacagagatgtcaagtccgccaacatattattagatgaaaac
ttcaccacaaaaatatcagattttggtgcttcaagattggtccctttagatcatgatcaa
gtcacgactcttgttcagggcacacttggttacttggatcctgaatacttccacacaagc
caattaaccgacaagagtgacgtttatagctttggcatggtcctagcagaactcataact
gggagattgccaatttgtgcagctagaaccaatgaagaaaaaaatttagcgacctacttt
gtcaagtcaatgaaagagaaccgcctttttcaaattgttgaaccacgattattacaagaa
gggactcttgagcagctacaaacagtagctgagctagtcaagagatgccttaacttacta
ggagatgaaagacctactatgaaagaggtggcaatggagctagagggcttgaggaagttc
acaactcatccttggaatcaacaacatgaacaagcgcctgaagaatctagaagcttaatc
cttgaagttgaacaatctgatctttatggtgtcccgttaatcccatatagtagtaacgaa
tgggaatcgtactcaggaataacagaaatggcatttcaagaaaacaaaccacgctaa

DBGET integrated database retrieval system