KEGG   Lactuca sativa (garden lettuce): 111883761Help
Entry
111883761         CDS       T05352                                 

Definition
(RefSeq) protein S-acyltransferase 24-like
  KO
K20032  palmitoyltransferase ZDHHC13/17 [EC:2.3.1.225]
Organism
lsv  Lactuca sativa (garden lettuce)
Brite
KEGG Orthology (KO) [BR:lsv00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lsv04131]
    111883761
Enzymes [BR:lsv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     111883761
Membrane trafficking [BR:lsv04131]
 SNARE
  SNARE associated proteins
   Palmitoyltransferases
    111883761
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC Ank_5 Ank_2 Ank_4 Ank_3 Ank cEGF
Motif
Other DBs
NCBI-GeneID: 111883761
NCBI-ProteinID: XP_023735848
Position
Unknown
AA seq 444 aa AA seqDB search
MYSGPPPIAGRCARYDKGPWEKPMKSQGRASEPAQAKIGTRRLEEQPEKGKAVETADSPV
RHTVRLTTADQEVTIPVFLFRPSGSTRRLLLGRRRKGRTPLHWAAYKGFADIVRLLLFLD
ANGKHQDKEGFIPLHWAAIRGNLTACRILVQAGKKDDLMMTDNSGLTPQQHASDRNHQQV
TNFLGNARKLHYEGGIFGKLSKLRLAAALVCVIFMLLLTYINSVIMASNFPTLTDVSAFF
AWIGVILATTGLILFYRCSCKDPGYIKSNRNDSKDTRDDEPLLKLELRDPAILAGKWTRL
CAACKIIQPLEAEHCDTCERCVEQLDHHCPLISNCIAKKNKWDFLGFLVLEVFAMMITGI
VSLTRIVRDPWAPSSIGGWLLHVGYQHVGVVLFLVSDIFLLICVSIFTYVQISQYNVDDF
QDKYIWKASTIARVSSVWSCRQYA
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgtactcggggcctcccccgattgctggaagatgcgcgcgatacgataaaggcccctgg
gagaaaccaatgaaaagccagggtagagcctcggagccggcccaagcgaagatcggcact
cgcaggcttgaggagcagcccgaaaaagggaaagccgtggagacggcagactcgccagtc
aggcacaccgtgaggctgactacagcagaccaggaggttacaattcctgttttcctgttt
cggccttcggggtcaactcggcggcttctattaggaagacggcgcaaaggaagaacccct
ttacattgggctgcatataaaggttttgcagatattgtacgtcttcttctctttctggat
gcaaatggaaagcaccaagacaaagaaggttttatacctttacattgggctgctatcagg
ggaaatttaacagcatgcagaatattagtgcaagcaggaaagaaagatgatttaatgatg
actgataatagtggccttacaccacaacaacatgcttctgatagaaatcatcaacaagtt
acaaatttccttggtaatgctaggaagttgcattatgaggggggtatatttgggaagcta
tcaaaactaaggctagcagcagcacttgtgtgtgtaatatttatgctacttttgacctat
atcaattcagtcatcatggcttcaaattttccaacattaacagatgtttctgcatttttt
gcatggattggtgtaatattagcaactacaggattaattcttttctatcggtgtagctgc
aaagatccaggttacattaaatccaacagaaatgattcaaaagatacaagagatgatgag
cctttacttaagcttgagttgcgggacccagcgatcctagctggcaaatggactcgactc
tgtgcagcttgtaagattattcaacctcttgaagcagagcattgtgacacatgtgagcgt
tgtgtggagcaattagaccatcactgccctttgatatctaattgcatcgcaaagaaaaac
aaatgggattttttgggttttcttgttcttgaagtttttgccatgatgataacgggtatc
gtttcccttacaagaattgtgagggatccatgggctccatcttctattggggggtggttg
ctacatgttggttatcaacatgttggtgttgtattatttttagtttcagatatttttctc
ttgatttgtgtctcgatttttacttatgtgcaaatttctcagtacaatgttgatgatttt
caggacaaatatatttggaaagcaagcactattgcacgggtatcgtctgtatggtcttgc
agacaatatgcataa

DBGET integrated database retrieval system