KEGG   Lactuca sativa (garden lettuce): 111887285Help
Entry
111887285         CDS       T05352                                 

Definition
(RefSeq) probable serine/threonine-protein kinase PBL23
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
lsv  Lactuca sativa (garden lettuce)
Brite
KEGG Orthology (KO) [BR:lsv00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lsv01001]
    111887285
Enzymes [BR:lsv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111887285
Protein kinases [BR:lsv01001]
 Serine/threonine kinases: TKL group
  IRAK family
   111887285
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PP2 APH Haspin_kinase Kinase-like
Motif
Other DBs
NCBI-GeneID: 111887285
NCBI-ProteinID: XP_023739221
Position
Unknown
AA seq 536 aa AA seqDB search
MVWKEMVAKWKEMVMRWRETTLLGVSPILDELIMSSIGKEYDHLKIQMEDIISATDNFSP
SKLIGRGGFGPVYKGELSLPTGSTMVAFKCLDHRSYQGNTEFWKEIMMLSKCKHENLVSL
LHFCIEDDERVLVYEYAAGGSLDHYLSDAKTLKWNQRLCICIEVARALNYLHDPVETQQR
VLHRDMKSSNILLDHNWTAKVSDFGLSKIGPANQPQTYLITNVVGTPGYTDPLYSETCLL
TKESDVYSFGVVLFEVMCGRLCYDCSTSGELTAILVPEWKKYYDENKLHDIIFRDLKEQM
VWDSFITFAAIARRCLERDRTERPTMDEILNELEVALEKQENTTFDDHLFKISKLAIPPL
PYKSRKELVLRLSDGILVDGRKRWLWINEHKQINEMESATESFHTLDRVDTFTNISRFLY
VRIMSTYSSYRYLVANVKTQFLSPNIAYTMNLVFKNLSRNENSQIYVPFKIKMEDDRLFR
NSSVPRVREDGWATTELYQFINKNKENSFRIEFFLEGHRQESVRMYAIEGIEFRPV
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atggtgtggaaggagatggtggcgaagtggaaggagatggtgatgaggtggagggaaacc
acgctgcttggcgtgtcccccatactcgatgaactaataatgtcttcaatcgggaaagag
tatgatcacctaaaaatccaaatggaagacataatatcggctacggacaactttagcccc
agcaaactcattgggcgtggtgggtttggtccggtgtacaaaggtgaactttctcttccg
acaggatcaactatggtagctttcaagtgcttggatcatagatcctatcaaggaaacacc
gagttttggaaggagatcatgatgctttctaaatgcaaacatgaaaatcttgtctctctc
ctgcacttttgcattgaggatgatgagagagtccttgtgtacgagtatgccgctggtgga
agccttgatcattatctaagtgatgctaaaacccttaaatggaaccaacggctttgtata
tgcatcgaggttgcacgtgcactaaactatcttcatgatcccgtggaaacacaacaaaga
gttctccatcgagacatgaaaagctcaaacatccttctggatcataattggactgctaaa
gtttctgattttggtttgtcaaaaataggcccagcaaaccaaccacagacatatctaatc
accaatgttgttggtacgccggggtatactgatccgttatattcagagacatgcttgcta
acaaaagagtcggacgtgtattcttttggagttgtgctgtttgaagtaatgtgtggcaga
ttatgttatgattgtagtactagtggtgaactaactgccattttagtgcctgagtggaaa
aaatattatgatgaaaataaactacatgatattatctttcgagatctaaaggaacaaatg
gtttgggattctttcattacatttgcagccattgcaagacgatgtttagaaagagatcgt
acggagcgacccacgatggatgagatcttaaatgaactcgaggttgcactggaaaaacaa
gagaatacaacttttgacgaccatttattcaagatttcaaagcttgcaatacctcctctg
ccgtacaaatcccgaaaggaactcgtcttacgtctctccgatgggattctcgtcgatgga
aggaaaaggtggctttggataaatgaacacaaacaaattaatgaaatggaatccgcaaca
gaatctttccatacattggatagagtcgatacctttactaacatatcaagatttttatat
gttagaatcatgagtacatactcttcttaccgttatttggttgcaaatgtcaagacccaa
ttcttgtcaccaaatattgcttacactatgaaccttgtcttcaagaatttgagcagaaat
gaaaatagtcagatatatgtacccttcaaaattaaaatggaagacgacagactctttcgt
aattcttctgttcctcgtgtcagagaagatggatgggcaacgaccgaactatatcaattt
atcaacaaaaataaggaaaatagttttaggattgagttctttcttgagggtcataggcag
gaaagcgtacgcatgtatgctattgaaggcatcgaatttcgacctgtgtag

DBGET integrated database retrieval system