KEGG   Lactuca sativa (garden lettuce): 111888116Help
Entry
111888116         CDS       T05352                                 

Definition
(RefSeq) nicotinamide/nicotinic acid mononucleotide adenylyltransferase-like isoform X1
  KO
K06210  nicotinamide mononucleotide adenylyltransferase [EC:2.7.7.1 2.7.7.18]
Organism
lsv  Lactuca sativa (garden lettuce)
Pathway
lsv00760  Nicotinate and nicotinamide metabolism
lsv01100  Metabolic pathways
Module
lsv_M00115  NAD biosynthesis, aspartate => NAD
Brite
KEGG Orthology (KO) [BR:lsv00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    111888116
Enzymes [BR:lsv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     111888116
    2.7.7.18  nicotinate-nucleotide adenylyltransferase
     111888116
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTP_transf_like
Motif
Other DBs
NCBI-GeneID: 111888116
NCBI-ProteinID: XP_023740000
Position
Unknown
AA seq 250 aa AA seqDB search
MDVELPVDKLMLVPIEENASSHSNTKGKIHVVLVSTGSFNPPTFMHLRLFELARDALNAK
GFNVVGGYMSPVNDAYKKKGLIPSEHRITMCQLVSKSSDFVMVDAWEAKQTSFQRSLTVL
SRIRSFFSDNGLIPNASLKVMLVCGSDLLESFGIPGAWIPDQVRSICRDYGVVCIRREGQ
DIEKIISHIDILTEYRNNIQVVDEIVPNRISSTLVRDCILRGLSVKYLTSDEVIDYIKRN
QLYTNQQQNV
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggatgttgagttaccagttgataagttaatgttagtgcccattgaggaaaatgcttca
tcacattccaacacaaagggaaaaatccatgtagttttggtatccacaggaagcttcaat
cctcctacattcatgcatttacgcctttttgaattggcaagagatgctcttaacgcaaaa
ggattcaatgtggttggaggttatatgtcgcctgtaaacgatgcatacaaaaaaaagggt
ctcataccatctgaacaccgtattacaatgtgccaattagttagcaaaagttctgatttt
gtaatggtggatgcatgggaggcaaaacaaacttcatttcaacgctcattgactgtgttg
tcaagaatcagaagcttcttttctgataatggactcatacctaatgcatctttaaaggtg
atgcttgtttgtggctctgatctgctagaatcatttggcattcctggagcttggatacct
gaccaggtgaggagtatatgcagagattatggtgttgtttgtatccgtagagaaggtcaa
gacattgagaaaatcatctcacacatagacattttgacagaatacaggaataacatccaa
gtggttgatgaaatagttccaaaccgtattagctcaactttagtaagagattgcattttg
cggggtttgtcagtgaagtatttgacatcagatgaagttattgattacatcaaacgaaac
cagctctacacaaaccaacaacaaaacgtgtag

DBGET integrated database retrieval system