KEGG   Lactuca sativa (garden lettuce): 111889827Help
Entry
111889827         CDS       T05352                                 

Definition
(RefSeq) glucose-6-phosphate 1-dehydrogenase, chloroplastic-like
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
lsv  Lactuca sativa (garden lettuce)
Pathway
lsv00030  Pentose phosphate pathway
lsv00480  Glutathione metabolism
lsv01100  Metabolic pathways
lsv01110  Biosynthesis of secondary metabolites
lsv01200  Carbon metabolism
Module
lsv_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
lsv_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:lsv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    111889827
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    111889827
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lsv04147]
    111889827
Enzymes [BR:lsv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     111889827
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     111889827
Exosome [BR:lsv04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   111889827
  Exosomal proteins of colorectal cancer cells
   111889827
  Exosomal proteins of bladder cancer cells
   111889827
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-GeneID: 111889827
NCBI-ProteinID: XP_023741748
Position
Unknown
AA seq 604 aa AA seqDB search
MATFSPSTHCPSSSAYSNSSSIINGSNRLHQRIGLSSILPKRCRSRKLSLQQSSNGVSLS
KAVHVQDGATNMKTSPVENDDPVKILKDGILSVPVVPPPEEVKDIASFDFDKDKSTVSIT
VVGASGDLAKKKIFPALFALFYEGCLPEHFTIYGYARSKMSDAELRTMVSKTLTCRIDQR
ENCGEKMDHFLERCFYHPGQYDSEENFLELDRKLKEHEAGRVANRLFYLSIPPNIFVDAV
KCASSSASSANGWTRVIVEKPFGRDSESSAALTRSLKQYLDEDQIFRIDHYLGKELVENL
SVLRFSNLIFEPLWSRQYIRNVQFIFAEDFGTEGRGGYFDNYGIIRDIMQNHLLQMLAIF
AMETPVSLDAEDIRNEKVKVLRSMRPLRLDDVVVGQYKSHTRGGVKYPAYTDDKTVPAGS
LTPTFAAAALFIDNARWDGVPFLMKAGKALHDRRAEIRVQFRHVPGNLYNKNIGTDLDLA
TNELVIRVQPDEAIYLKINNKVPGLGMRLDRSNLNLLYAARYSKEIPDAYERLLLDAIEG
ERRLFIRSDELNAAWSLFSPVLKELEEKKIVPEYYPYGSRGPVCSHYLAAKYKVRWGDIG
SDQQ
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgttttctccatcgacacattgtccatcgtcatcggcttattcgaatagttcg
tccatcattaatggtagtaatcgacttcatcaacgtatagggctatcctcaattcttccc
aaacgatgtcgttcaagaaagttgtctctacaacaatcatccaacggggtctcactctcg
aaagctgttcatgttcaagatggtgctacaaacatgaaaacatcccctgttgaaaatgat
gatcctgttaagatattgaaagatggaatattatccgtacctgtggtaccacccccagaa
gaagtcaaagacattgcaagctttgattttgataaagacaagtctactgtcagtataaca
gttgttggagcctcgggtgatcttgcaaaaaagaagatctttcctgcactttttgcactt
ttttatgaaggctgcctccctgagcatttcacgatatatggatatgcacgaagtaagatg
agtgatgccgaacttagaaccatggtcagcaagacacttacatgcagaattgatcaaagg
gagaactgtggtgaaaagatggatcactttcttgaaagatgtttctatcatcctggtcaa
tatgattctgaagaaaactttttggagcttgatagaaagctcaaggaacacgaggctgga
agggttgcaaatcgtctgttctatctatcaattccaccaaatatttttgtagatgcagtc
aaatgtgccagctcatctgcatcatctgcaaatggatggacaagggtaattgtggaaaag
ccatttggtcgggattctgaatcctctgctgcattgacaaggtccctcaagcaatacttg
gatgaagaccaaattttcaggatagatcattatcttgggaaagagctagtggagaatctt
tcagtccttcgattttccaacctaatttttgaacccttgtggtcaagacaatatataaga
aacgtacaattcatatttgctgaagattttggcactgaagggcgaggaggatactttgac
aattatggaataattagagacattatgcaaaaccatctgcttcaaatgttggctattttt
gccatggaaacccctgtgagcttggatgcagaagatatcagaaacgaaaaggtgaaagtt
ttacgttccatgaggcctctgcgacttgatgatgtggtggtaggacagtataagagtcac
acaagagggggtgttaagtacccggcttatacagatgacaagactgtgccagctggcagt
ctaacaccaacttttgctgctgctgctctttttattgataatgccagatgggatggagtg
ccctttttgatgaaagctggaaaagctttacatgatcgaagggctgagatacgagtgcag
tttagacatgtacctggtaatctgtacaacaagaatattgggacagatcttgacctggca
acaaatgagcttgtgatccgtgtgcagcctgatgaagccatatatctcaagatcaacaac
aaagtccctggtttggggatgagattggaccgaagtaatcttaatcttctctatgcagca
aggtactcaaaggagattcctgatgcgtatgagagacttcttctggatgcaatcgaagga
gaaagaaggctttttatacggagtgatgagctgaatgcagcctggtctttattcagtcct
gtactgaaggagcttgaagagaagaagattgtgcccgagtattacccgtatggcagccgg
ggtccggtttgctcccactatcttgctgccaagtacaaggttcggtggggtgatattggt
tcagaccagcagtaa

DBGET integrated database retrieval system