KEGG   Lactuca sativa (garden lettuce): 111892409Help
Entry
111892409         CDS       T05352                                 

Definition
(RefSeq) sphingosine kinase 2-like
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
lsv  Lactuca sativa (garden lettuce)
Pathway
lsv00600  Sphingolipid metabolism
lsv01100  Metabolic pathways
Module
lsv_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:lsv00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    111892409
Enzymes [BR:lsv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     111892409
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat Tim54
Motif
Other DBs
NCBI-GeneID: 111892409
NCBI-ProteinID: XP_023744225
Position
Unknown
AA seq 481 aa AA seqDB search
MEQQHLLSVSDEVFVNGGKSSLTLSVDGILQWLDGGLIRRCLSVEKEVLGFSKSGRLITI
RALVQTAADRFCFGSSGEGSLTRKRFVFEAVTEDSLRNLCEKIQGYIDSLGRPKKLFIFV
NPFGGRKSASKIFTNDIKPILEDANIEYTLQETRYQLHAKEVSCSLDLTKYDGIICVSGD
GILVEVVNGLLERKDWAVALKVPLGVIPAGTGNGMIKSLLDSVNQPCTPAHATLAVVRGH
KRSLDVATIWQGETTFFSVLMLAWGLVSDIDIESEKYRWMGSARIDFYALKRILRLRKYN
GSICFVPGPGFEDVGESNDSCVDSMEPLIMPRQHGYQGPNIDLKNLNWRKIEGPFVSVWL
HNVPWGAENTMAAPDAKFEDGYLDLIIVRQCPKLALLSLMSELNNGGHVKSPYVVYIKVK
AVILEPGSRTDDSMKEGIIDSDGEVLARGKGTYKCNLKSLMAYDKIQVVVDQGLATLFTP
I
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atggaacaacaacatttactctccgtttccgatgaagtattcgtcaacggaggcaaatca
tcactcacgctctctgtcgacgggatactccagtggttggatggaggtttaattcgccga
tgcttgtctgtagagaaggaagttcttggattctcaaaatccggacgcctgatcacaatt
agggcacttgttcaaactgccgctgatcgattttgcttcggaagtagtggcgaagggagt
ttgacgaggaagaggttcgtatttgaggcggtgacggaggattcgttacggaatttatgc
gagaagattcaagggtacatcgattcgttaggtcgaccaaaaaagctcttcatattcgtt
aatccgtttggtgggaggaaatctgcttccaagatttttactaatgatataaaaccaata
cttgaagatgctaacatcgaatacacattgcaagaaacaagataccaacttcacgcgaag
gaagtttcttgttcgttagatcttacaaagtatgatggtataatatgtgttagcggggat
ggcatattggttgaggttgtgaatggattgcttgaaagaaaagactgggcagttgcactc
aaagtgcctcttggagtcatacctgcaggtactgggaatggcatgataaaatccctttta
gattcagtcaatcagccatgtactccagctcatgctactcttgctgtagtccgagggcat
aaacggtctttagatgtagctacaatctggcaaggagagactacattttttagcgtctta
atgcttgcatggggacttgtatcagatatagacatcgagtccgagaaatatcggtggatg
ggaagtgctcggatagatttctatgctcttaaacgaattctaaggctgcgaaaatataat
gggagtatatgttttgtacctggacccgggtttgaagatgtgggagagtcaaatgattcg
tgtgttgattctatggaacctcttattatgccacgtcagcatggttaccaaggtcctaat
attgatttaaagaatttaaattggagaaagattgaaggtccctttgtttctgtttggctt
cataatgttccttggggtgctgaaaacactatggctgcccctgatgccaagtttgaagat
ggctatttggacttgattatagtgaggcaatgtccaaagttggccttgttgtccttaatg
tctgaattgaacaacgggggccacgtgaaatcaccctatgttgtgtacatcaaggtgaaa
gcggtgatattggagcccgggtcgagaacggatgactcgatgaaagaagggattatagat
tcggatggggaagtgttggcgagagggaaaggaacttataaatgtaacttaaaatcattg
atggcatatgataagatacaagttgttgtggatcaaggtttagccactctctttacacct
atttaa

DBGET integrated database retrieval system