KEGG   Lactuca sativa (garden lettuce): 111893339Help
Entry
111893339         CDS       T05352                                 

Definition
(RefSeq) putative receptor-like protein kinase At5g39000
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
lsv  Lactuca sativa (garden lettuce)
Brite
KEGG Orthology (KO) [BR:lsv00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lsv01001]
    111893339
Enzymes [BR:lsv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111893339
Protein kinases [BR:lsv01001]
 Serine/threonine kinases: TKL group
  IRAK family
   111893339
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 111893339
NCBI-ProteinID: XP_023745175
Position
Unknown
AA seq 332 aa AA seqDB search
MSLIRESQHLHVPFRDIKFATKNFTTLIGSGGFGYVYKGELSLSGKLTSVAVKRLPNNNN
HSGQGLKEFLTEIQLLSRYKHPNLVSLLGYCDEDDEKILIYEYASYGSLDRYLSMSNTTF
PLTWKQRISICIGAARGLDYLHNHVAENHRVIHRDIKSANILLDHNWKAMISDLGLSKIG
RANENESYLITNVAGTHGYCDPVYMKTGILTKESDVYSFGVVLFEVLCGRPCFMNVDGEE
RFLPKLAQTCYERGNLNDIIDHDLKKQMASDSLNMVSKIAYQCLQNDRKQRPSMGLVVEK
LEKALDLQEVDEKSGPMIQILHGKVLVEGCFP
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctcattagagagtcacaacacctccatgtaccctttagagatattaaattcgcc
actaaaaacttcacaaccttgatcggaagtggtggatttggctatgtttataaaggagaa
ctctcactttcaggtaaacttacctctgttgctgtgaagcgactaccaaataataataac
cattctggtcaaggtcttaaggagttcttaacagagattcaattactctcccgctataaa
catccaaatctagtctcccttcttggttactgtgatgaagatgatgagaagatccttatt
tacgagtacgcaagttatggaagcctcgacaggtacctaagtatgtctaatacaacgttt
ccactcacatggaagcaacgaatcagtatatgcattggagcagcacggggtttggattat
cttcataaccatgttgcagaaaatcatagagttatccacagggatataaagagtgcgaat
attctattagatcacaactggaaagctatgatttcagatctgggtctttccaagataggt
cgtgcaaatgaaaatgagagttatctcattacaaatgttgctggcacacatgggtattgt
gatcctgtgtacatgaaaacaggtatcctcacaaaagagtcggatgtttattcatttggg
gtggtgttgtttgaagtcttatgtgggaggccgtgcttcatgaacgtagatggtgaagag
cgattcttacccaaactagcccagacctgctacgaaaggggaaatttaaatgatataatt
gatcatgatttgaagaaacaaatggcctcagattccttgaatatggtctcaaagattgca
tatcagtgcttgcagaatgatcggaaacagcgaccctcaatgggattggtggtagagaaa
cttgagaaagctttggatttgcaagaagttgacgaaaaatcgggtcccatgattcagatt
ctacatggaaaggttttggttgaaggttgttttccgtag

DBGET integrated database retrieval system