KEGG   Lactuca sativa (garden lettuce): 111893702Help
Entry
111893702         CDS       T05352                                 

Definition
(RefSeq) succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial
  KO
K01900  succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5]
Organism
lsv  Lactuca sativa (garden lettuce)
Pathway
lsv00020  Citrate cycle (TCA cycle)
lsv00640  Propanoate metabolism
lsv01100  Metabolic pathways
lsv01110  Biosynthesis of secondary metabolites
lsv01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lsv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    111893702
   00640 Propanoate metabolism
    111893702
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lsv04147]
    111893702
Enzymes [BR:lsv01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     111893702
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     111893702
Exosome [BR:lsv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   111893702
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 Succ_CoA_lig GARS_A
Motif
Other DBs
NCBI-GeneID: 111893702
NCBI-ProteinID: XP_023745537
Position
Unknown
AA seq 423 aa AA seqDB search
MVRGLLNKLATKSINVAGKWQQQQLRRLNIHEYQGAELMGKYGINVPKGVAVSSVEEVRK
AIQTTFPNEKELVVKSQILAGGRGLGKFTSGLQGGVHIVKIDQAEEIAGKMLGQTLVTKQ
TGPQGKVVSKVYLCEKVSLVNEMYFAITLDRTTAGPLIIACREGGTSIEDLAEKFPDMII
KVPIDVFKGITDEDAAKVVDGLAPKVADRDASIEQVKKLYNLFHESDCTQLEINPIAETS
DNKLVAADAKLNFDDNAAYRQKDIFALRDPTQEDPREVAAAKADLNYIGLDGEIGCMVNG
AGLAMATMDIIKLHGGTPANFLDVGGNASEGQVVEAFKILTSDEKVKAILVNIFGGIMKC
DVIASGIVNAAKHVSLKVPVVVRLEGTNVDQGKRILKESGMALITAEDLDDAAEKAVKAL
GSS
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggtgagaggattgttgaacaagctcgcaactaaatcgatcaatgttgccggaaaatgg
caacagcagcagctccgtcgcctcaacatccacgagtatcagggagctgaactgatgggc
aaatatggtattaacgttccaaaaggtgttgctgtttcttctgttgaggaagttcgaaag
gccatacaaacaacatttcctaacgaaaaggagttggttgttaagagccaaattcttgct
ggtggacgaggtctaggaaaattcacaagtggtcttcagggtggagttcacattgtcaaa
atcgaccaggctgaagagatagctggaaagatgcttgggcagactcttgtcactaaacaa
actggcccccaaggcaaagttgtcagcaaggtttatttatgtgaaaaagtgtcacttgtg
aacgaaatgtactttgcaatcactcttgatcgtacaactgctggtcctcttatcattgca
tgccgagagggaggaaccagcattgaagaccttgcagagaaattccctgacatgatcatt
aaagtgcctattgatgttttcaaaggaattacagatgaagatgctgccaaggttgtagat
ggtcttgctcctaaggtggctgacagagatgcttcaatagaacaggtgaagaagctgtac
aaccttttccatgaatccgattgcacacagttggagatcaatccgatcgcagagacttct
gataacaagctggtagctgctgatgcgaagctaaactttgatgataatgctgcttaccgt
caaaaagacatatttgcccttcgtgatccgacacaggaggatcctcgtgaggttgcagct
gcaaaagcggatttgaattatattggtttggatggagaaattggatgcatggtgaatggt
gctggattggcaatggcaaccatggatatcataaagttacatggaggcacccctgccaac
tttctggatgtaggtgggaatgcttccgaaggacaggtggttgaagcattcaagatcttg
acatcagatgagaaagtcaaagcaatattggtcaacatttttggaggaataatgaaatgc
gatgtcatagccagtggaattgttaatgctgctaaacatgtttcattgaaggtgccggtt
gtagttcgtcttgaaggcacaaatgttgaccaagggaagagaattctcaaggaaagcggg
atggcattgattacagcagaggatcttgatgacgcagctgaaaaggcggttaaagcgctt
ggatcatcataa

DBGET integrated database retrieval system