KEGG   Lactuca sativa (garden lettuce): 111893804
Entry
111893804         CDS       T05352                                 

Definition
(RefSeq) delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
lsv  Lactuca sativa (garden lettuce)
Pathway
lsv00100  Steroid biosynthesis
lsv01100  Metabolic pathways
lsv01110  Biosynthesis of secondary metabolites
Module
lsv_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:lsv00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    111893804
Enzymes [BR:lsv01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     111893804
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 111893804
NCBI-ProteinID: XP_023745656
Position
Unknown
AA seq 369 aa
MDFTSLIISFIPSWTSVGLLLGFFSYLGIAGSILPGKLIPGANLSDGTRLHYRCNGMLSL
LLLVGLLIIGAWMDYVSLTAISDRGLELLSTTFIFSVIVTLLLYVAGCKSKDQSASLKPH
ITGNILDDWWFGIQLNPSFMGVDLKFFFVRAGMMGWLLINLSVLAKSIQDANLSQSMILY
QLFCVIYIMDYFFYEEYMTSTWDIIAERLGFMLVFGDLVWIPFTFSIQGWWLLSNKVELT
TAAMIANCCVFVIGYLVFRGANKQKHDFKKNPKALIWGRPPKVVGGKLLVSGYWGIARHC
NYLGDLLLALSFSLPCGISSPVPYFYPIYLLILLIWRERRDESRCAHKYKEVWAEYRKAV
PWRILPYVY
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggacttcacttcacttatcatctccttcattccctcatggacttctgttggtttatta
ttgggattctttagttacttgggcattgctggatctattttacctggaaagcttattcct
ggagcgaatctatctgatggaactagacttcattatcgctgtaatggaatgctatcactt
cttttgctggttggactacttatcattggagcttggatggattatgtatcactcactgca
atatcagaccgagggcttgagctcttatcaacaacttttatcttcagtgttattgtcaca
ttgttactttatgttgctggatgcaaatctaaagatcaaagtgcatctctaaagcctcac
atcactggaaacatacttgatgactggtggtttgggatacagttgaatccaagcttcatg
ggtgttgacctcaaatttttctttgtgagagctggaatgatggggtggcttctcattaat
ctttcagttcttgcaaaatctatccaagatgctaacttgagccaatcaatgatcctctac
cagcttttttgtgtgatatacatcatggattacttcttttatgaggaatacatgacatcc
acatgggatataattgcagagaggctaggattcatgctagtatttggagatctagtgtgg
attcccttcacatttagcattcagggttggtggcttttgagtaataaggtggagttaaca
acagctgcaatgattgcaaattgctgtgtgtttgtgattgggtatctggtttttagagga
gctaataagcaaaaacatgactttaagaagaatccaaaagcattgatatggggtaggcct
ccaaaagttgttggagggaaattactggtttctggttattggggaatagcaaggcactgc
aattaccttggagatctgttattggccctatccttcagcttaccctgtgggatcagttct
ccagttccatatttttatccaatttatcttctgattctgctgatctggcgagagagaaga
gacgaatccagatgtgcacacaaatacaaagaggtctgggcagaatatcgcaaggctgtt
ccatggagaattctaccatatgtttactag

DBGET integrated database retrieval system