KEGG   Lactuca sativa (garden lettuce): 111893843Help
Entry
111893843         CDS       T05352                                 

Definition
(RefSeq) probable methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
lsv  Lactuca sativa (garden lettuce)
Pathway
lsv00450  Selenocompound metabolism
lsv00970  Aminoacyl-tRNA biosynthesis
lsv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lsv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    111893843
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    111893843
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lsv01007]
    111893843
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lsv03016]
    111893843
Enzymes [BR:lsv01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     111893843
Amino acid related enzymes [BR:lsv01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   111893843
Transfer RNA biogenesis [BR:lsv03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    111893843
 Prokaryotic type
   Other AARSs
    111893843
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e
Motif
Other DBs
NCBI-GeneID: 111893843
NCBI-ProteinID: XP_023745694
Position
Unknown
AA seq 811 aa AA seqDB search
MGDISTGVGDDRKVTKLPIPGKRNILITSALPYVNNVPHLGNIIGCVLSADVFARYCRLR
GYNAIYICGTDEYGTATETKALEENCTPKEICDKYHAIHRDVYKWFNISFDEFGRTSSPA
QTEVCQAIFKKLLENNWLSENTMQQLYCDTCNKFLADRLVEGNCPTPGCNYDSARGDQCE
KCGKLLNPTELINPRCKVCKTSPRIRDTDHLFLELPLLEEKLREYISTMSVAGGWSQNAI
HATNAWLKEGLRQRCITRDLKWGVPVPLEKFKEKVFYVWFDAPIGYVSITKCYTPEWEKW
WKNPENVELYQFMGKDNVPFHTVMFPSTLIGTEENWTMMKTISVTEYLNYETGKFSKSKG
VGVFGNDAKDTNIPVEVWRYYLLTNRPEVSDTLFTWADLQAKLNSELLNNLGNFINRVLS
FIAKESGLGYGSIIPDAPNAESHLLTKTLGDKIGDYVDQYVEAMEKVKLKQGLKLAMSIS
GEGNAYLQESQFWKLYKEDLPSCSIVMRTSVGIVYLLACLLEPFMPSFSIEVLKQLNLPL
QLSLCDDKGDIKKAKTPWEFIPIGHKIGTPVPLFKELKDEEVEFFRNKFAGSQADRADRA
VKEEAEAKKVTEKLKNTKISDKSGKKEKGEKSGVSEKAKTKGAPAVEKEVTISRLDIRVG
VITEVQKHPDADSLYVEQIDVGEEQPRTVVSGLVKFIPIEQMKNRKVCVLCNLKAATMRG
IKSHAMVLCASTSDKVELVEPPEDAVVGERVKFSGFDGEPDDVLNPKKKIWETLQVDLHT
DKDLIACFKDLPFTTSAGVCRVSSISNGTIR
NT seq 2436 nt NT seq  +upstreamnt  +downstreamnt
atgggagatatttcgactggtgttggagacgatcggaaagtgacgaagcttccgattccg
ggcaaaagaaacatccttattaccagtgcccttccttatgtcaacaacgttcctcacctt
ggaaacatcattggatgtgtgttgagtgctgatgtgtttgctcgatattgtcgattgagg
ggatacaacgcgatatacatatgtggaactgatgagtatggtacagctaccgagacaaag
gctttggaagaaaactgtactcctaaagaaatttgcgacaagtatcacgcaattcacagg
gacgtgtataaatggtttaacataagttttgatgaatttggacgaacttcgtctccagca
cagactgaagtttgccaagcaattttcaaaaagttgctggagaataattggctttctgag
aatacaatgcagcagctttactgtgatacatgcaataagtttttagcagatcggcttgtt
gagggtaactgtccaacaccaggttgtaattatgactctgcaagaggagatcaatgtgaa
aaatgtggcaagctattaaatccaacagaactcatcaatcctagatgcaaggtctgcaaa
acaagccctagaattcgtgatacagatcacttgtttcttgaactccctttgttggaagag
aaactacgcgaatacatcagcaccatgtcagtggccggtggttggagtcagaatgccatt
catgcaacaaatgcatggcttaaagaaggattaaggcaacggtgtattactagagatctg
aagtggggtgtccctgtccctcttgagaaattcaaagagaaggttttctatgtatggttt
gatgcacctattggatacgtgtcaattactaaatgctacacacctgagtgggagaagtgg
tggaaaaatcctgaaaatgtggagctatatcagtttatgggaaaggataatgttccattt
cacactgtaatgtttccttctacacttattgggactgaagagaactggactatgatgaaa
actattagtgttacagagtacttaaattatgaaacaggtaaattctcaaagagtaagggt
gtaggtgtatttggaaatgatgcaaaagatacaaatattcctgtagaagtatggagatac
tatctgttaacaaatagacctgaggtatcagacacgttatttacatgggcagatttgcaa
gcgaaattaaacagtgaattgctaaataatttaggaaatttcataaaccgagtcttgagc
tttatagctaaagaatcaggtttaggatatggttccattattcctgatgctccaaatgca
gaatcacatcttttaacaaaaactttgggagataaaattggtgactatgttgaccaatat
gtagaggccatggagaaggtcaagctaaagcaaggattgaaacttgcaatgagcatttct
ggtgaggggaatgcatatcttcaagagagtcaattctggaagctgtacaaggaagacctc
ccatcatgttcaatagtcatgagaacttcagttggcatagtctatcttcttgcatgcctt
ctagaaccttttatgccatccttttccattgaggtactcaagcagctcaatttgcccctt
caactatctctctgtgatgataagggagatatcaagaaggccaaaaccccttgggagttc
attcctattggccacaaaatcgggacccctgttccattatttaaggaattgaaagatgaa
gaagtggagtttttcaggaataaatttgctggcagtcaagctgaccgagctgaccgggct
gttaaggaagaagccgaagcaaaaaaagttacagaaaagttgaagaacaccaaaatttca
gataaaagtggaaagaaagaaaagggggagaagtctggtgttagtgaaaaagcaaaaaca
aagggagctcctgctgtggaaaaggaagtaacaatcagtaggcttgacatccgtgttgga
gttatcacagaagtccagaagcatccggatgctgattctttatatgttgaacaaatcgat
gttggtgaagaacaacctaggactgttgtcagtggccttgtcaaatttatacctatcgaa
cagatgaagaatcggaaggtttgtgttttgtgtaacctaaaggcagcaaccatgaggggg
atcaagtcacacgcgatggttctttgtgcttccactagtgataaggttgaactggttgag
ccacctgaggatgctgttgttggtgagagggttaagttttcagggtttgatggggagcct
gatgatgtgttgaaccctaagaagaagatttgggagacactacaagtggatttgcataca
gataaggatcttatagcttgctttaaagatcttccatttacaacttctgctggtgtttgc
agggtttcatccatatccaatggaacaattcgatga

DBGET integrated database retrieval system