KEGG   Lactuca sativa (garden lettuce): 111895671Help
Entry
111895671         CDS       T05352                                 

Definition
(RefSeq) probable receptor-like serine/threonine-protein kinase At4g34500
Organism
lsv  Lactuca sativa (garden lettuce)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr EphA2_TM LRRC37AB_C MAM1 SCIMP Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 111895671
NCBI-ProteinID: XP_023747516
Position
Unknown
AA seq 464 aa AA seqDB search
MAVSGNTSSTDGGVSLTSKTPIFGQKLYVIVAVTVLIVTAVLVAIFCCIRRNLNSKRRRR
MRVKHSSGLLPLVSEAINIEKIEKTSKISVFQKDDREKEEIRPIINVVEGKLGNTNSGSN
ESGTSWSEGASTSLSADGMNNLGWGRWYSLNELEIATSNFTPENVIGEGGYGIVYRGVVR
DGFVAVKNLLNNKGQAEKEFKVEVEAIGKVRHKNLVGLLGFCADGAKRLLVYEYVDNGNL
EQWLHGDVGPISPLTWDIRMKIAIGTAKGLAYLHEGLEPKVVHRDVKSSNILLDRKWNAK
VSDFGLAKLLGSEKSHVTTRVMGTFGYVSPDYASTGMLNECSDVYSFGVLLMEMVTGRSP
VDYSRAPGEMNLVDWFKGMVASRRGEELLDPKISIQPPSRALKRVLLVCLRCIDMDANKR
PKMGQIVHMLEADDFPFRTEHRPPRDTGMLNSGVDAASKTTSMK
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgtccggtaacacatcctccaccgacggcggtgtcagtctcacctcgaaaaca
ccaatatttggccaaaaactgtacgtcatcgtcgccgtcaccgtactaattgttacagct
gttctcgtagcgatcttctgttgtattcgtcgaaatttgaattctaaacgacgtcgtagg
atgcgcgtgaagcacagctcgggattgttgccgttggtctcggaggcgatcaacatcgag
aagattgagaaaacatcgaaaatcagtgtttttcagaaggatgatagagagaaggaagag
attagaccgataatcaatgttgttgagggtaaattagggaatacgaattctggtagtaat
gaatcgggtacgagttggagtgaaggggcgtcaacgtcgttgtcggcggatggtatgaat
aatttaggttggggcaggtggtacagcctgaatgagcttgaaattgcgacgagtaacttt
acgccggagaatgtgatcggagaaggagggtacgggattgtgtatagaggtgttgtacga
gatggttttgtggctgtgaagaatcttctgaacaacaagggtcaagcagaaaaggaattt
aaggtggaggttgaagccattggaaaagttaggcataaaaacttggtgggtctccttgga
ttttgcgcagatggtgctaaaaggttgcttgtgtatgagtatgttgataatggaaatttg
gaacaatggttgcatggtgatgttggaccaataagccctttaacatgggatattcgaatg
aagattgcaattgggacagctaaagggttggcatatttacacgaaggattggaaccaaaa
gttgttcatcgtgatgttaaatcaagcaacattctcctcgatagaaaatggaatgcaaaa
gtatccgattttggacttgccaaattattaggatccgaaaaaagccatgtcaccacacgt
gtaatgggcacattcggatacgtatcacccgactatgcaagcacggggatgttgaatgag
tgtagtgatgtttacagttttggagttttacttatggaaatggttacaggaagaagcccc
gttgattattctagagcacccggagagatgaatttggtcgactggtttaaaggaatggtg
gcaagtcgtcgtggagaagaattgttagatcccaaaattagcatacaacctccttcaaga
gctttaaagcgcgtgttgctagtgtgtcttcgttgtatagatatggatgcaaataagcgt
ccaaaaatgggccaaatcgtacacatgctcgaagcagacgatttccctttccgcaccgag
catcgtccgcctagagacacgggtatgctcaattcgggtgtggatgccgcaagtaaaaca
acttcgatgaaatag

DBGET integrated database retrieval system