KEGG   Lactuca sativa (garden lettuce): 111896435Help
Entry
111896435         CDS       T05352                                 

Definition
(RefSeq) protein PHYLLO, chloroplastic
  KO
K14759  isochorismate synthase / 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase / 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase / O-succinylbenzoate synthase [EC:5.4.4.2 2.2.1.9 4.2.99.20 4.2.1.113]
Organism
lsv  Lactuca sativa (garden lettuce)
Pathway
lsv00130  Ubiquinone and other terpenoid-quinone biosynthesis
lsv01100  Metabolic pathways
lsv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lsv00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    111896435
Enzymes [BR:lsv01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.9  2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase
     111896435
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.113  o-succinylbenzoate synthase
     111896435
   4.2.99  Other carbon-oxygen lyases
    4.2.99.20  2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase
     111896435
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.4  Transferring hydroxy groups
    5.4.4.2  isochorismate synthase
     111896435
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPP_enzyme_N MR_MLE_C Abhydrolase_1 Abhydrolase_6 TPP_enzyme_M_2 Ndr TPP_enzyme_C Hydrolase_4 Abhydrolase_2 DUF676 BAAT_C Abhydrolase_3 Chlorophyllase DLH DUF726 Esterase Thioesterase DUF900 Abhydro_lipase
Motif
Other DBs
NCBI-GeneID: 111896435
NCBI-ProteinID: XP_023748191
Position
Unknown
AA seq 1661 aa AA seqDB search
MNLQIKLHSSPSSFLHFHTITFLPSKTNITIPSRNRFTFLRQRRNAPNFKIVRSSMQVNE
VKFMEAEEAELLLATCITRTLPPALTLESGLEKIRDSVEDLKSKPRAKAGMYRYQIAVSP
GSRALSLFCSQDPSLGVFPQFFVSTEFEKPTNKFLSFTTSHGVFGIGVAVFIKTPFSSTS
IENISFRRYQSLDSTHLKAYGLFGHNSVKYENISPYMFIPQIELVESDGLSILSATLAWN
DSSLYPYDKAFDVIIYLTTALTRPIANECLNKSINAVLKKFNMVEDKHAQMVYTDALLLR
EGCLDHMELENTSSSYQFSLRLSATVVVCNNMLDQFRDIAHSLKQSSNINTLWASLIIEE
CYRLGLTYFCIAPGSRSTPLAIAATSHPMTNCIACFDERSLAFHAIGYAKGSQKPAVVIT
SSGTAVSNLLPAVVEASQDFLPLLLLTADRPPELLDTGANQAINQVNIFGSFVRQFFNLP
VPTDDISARMVLTTVDSAVNHATSSPCGPVHINCPFREPLENTPKEWSQSCLKGLEFWVS
SSQPFTNYFQSHDSFTHGDVADVLGVIQGAKHGILLIGAIFKEDDIWASLLLAKHLKWPV
FADILSGLRLRKYKNSVLKLNESILFVDHLDHLLLSPEVRNRINPDVILQIGSRITSKRV
SQMIQDSSPCQYILVDNHPNRHDPSHVITHRIQGHIRHFTNCVMRSCTTKINTQWTNFLC
SINMMVEWEISFLIHSENNLSEPYVAHVTSEAIEFGSTMFIGNSMPIRDADMYGSSHGKG
SHGKITKLPSGFPFTWIQVAGNRGASGIDGLLSTAIGFAVGHNKKVVCVIGDVSFLHDTN
GLALLKQRISRKQMTIIVINNHGGAIFSLLPIANKAEEKILSQYFYTSHDVGIHNLCNAH
GVKHVHVSTKSELQKALLNSQHEESDCVIEVESSIDANKNFHSNLRQFSCQAAGNSLSII
SKLSVLNSIKVHKLEFFQYRIQLCAPLTTPVVNDNYREGFVLTLYLEDGSTGIGEVAPLG
THKGTLQDAQEQLQFLTHVIKGSTLHSSLPLLNGSFSSWIWTNLGIPPDSILPSVRCGLE
MAILNAIASVQGCSSSMLNILHPSAPKQESPQKSSNITICALLDSNGTPSEVAYLASKLV
EEGFTTIKLKVARRAHPIEDAQVIQEIRKKIGFHIQLRVDANKKWSFNDALQFGSNVKEC
ELQYIEEPVNDEDDIIKFCEESGIPVALDETIDNLQENPLQALSRFTHDKIVAVVIKPSF
VGGFEKAAYIARWAHHHGKLAVVSAAFESGISLSAYVQFSCFLEMKNKDICKIMNKEIVS
DVAHGLGTYKWLKDDVIITESLCFTKSQASVFDAGQTLTNFKINRNSVFRSFESEKLWNY
TQKVDVEGMTFSINVKELGDKRNDNVIVFLHGFLGSSEDWIPIMNAMSASSRCIAIDLPG
HGGSKMDAIDDVAQGVELSMQVVTDMLEKLVLVLTTKKVTLVGYSMGARITLYMALKFKN
MIKGVVMISGSPGLDDVAKRKSRSVKDDSLACALVSYGVELFIETWYSGEMWESLRSHPQ
FEQIVADRSKHDDVSGLVKTLSGLSTGRQPSLWEDLKHVKSPVVVIVGERDEKFKKIGER
MCVTLGKSRVVEVPNCGHAVHIESPLLVIRSITEFLTRLDS
NT seq 4986 nt NT seq  +upstreamnt  +downstreamnt
atgaatctccagatcaagctacattcttctccctcttccttcctacatttccatactatc
acctttctgccttctaaaaccaacatcaccataccctcccgcaatcgcttcacatttctt
cgtcagcgccggaatgctccgaatttcaagattgtgcggagttcaatgcaagtaaacgaa
gttaaattcatggaggcggaggaggccgaactactcctggctacctgcattacgcgtaca
ttgcctccagcactgacgctagaatcgggactcgaaaagattagagattcggttgaggac
ttgaagtcgaaacctcgtgctaaagctggaatgtacagatatcagattgctgtatcccct
ggttcaagagcattgagtttgttttgcagtcaagatccatcactaggagtatttcctcag
ttttttgtttctacagagtttgagaagccaaccaataagtttctctcattcactacaagt
catggagtctttggaattggtgttgcggttttcatcaagactcctttttcctctacctca
atagagaacatttctttcagaagatatcagtcccttgattcaacacatctgaaggcttat
ggtttatttggccacaattctgtaaagtatgagaacatatcaccctacatgttcattccc
caaatagaattagtcgagtctgatgggttatccatattatccgccacactagcatggaat
gactcttccctttatccatatgacaaggcttttgatgttattatttatctcacaacagct
cttacaaggcccattgcaaatgaatgtctgaacaaatcaattaatgctgttctaaaaaag
ttcaacatggtggaggataaacatgcacaaatggtatatacagatgctcttttgctgagg
gaaggttgccttgaccacatggaactggaaaacacatcatcatcataccagttctcccta
agactttcagctactgtagttgtctgcaataacatgctggatcagttcagagatatagct
cattctttaaaacaatcttcaaacatcaatacattgtgggcatcactaataatcgaagaa
tgctatcgactcggtttaacttacttttgtatagctccaggatcacgttccactccacta
gccattgctgcaacttctcaccctatgacaaattgcattgcatgctttgatgaaagatca
cttgcttttcatgctattggttatgcaaaaggctctcaaaaaccagctgtggttataacc
tcatcaggcactgcagtttcaaatcttttacctgctgtagtggaagcttctcaagatttt
ttacctcttctattactcacagcagatcgcccccctgagcttcttgatactggagccaac
caagcaattaatcaagttaacatatttgggtcatttgtgaggcaatttttcaatcttcct
gtacccacagacgatatttctgcaagaatggttttaacaactgttgactctgctgtaaat
catgccacgtcatcaccttgtggacctgtacatatcaattgtcctttcagggagcctcta
gaaaacacaccaaaagaatggagtcaaagttgcttaaaaggattagagttttgggtatca
agtagtcaaccatttacaaactatttccaatctcatgattctttcacacatggtgatgtg
gcagatgtgttaggtgtaatacaaggtgcaaaacatgggattctgctaattggtgcgatt
tttaaagaggatgatatctgggcatctttattattagctaaacaccttaaatggccagtt
tttgctgatattttatcaggtttaaggttgagaaaatataaaaattctgttttgaaactt
aatgagagtattctttttgttgatcatttggatcatttgctactttctcctgaagtcaga
aatcggataaatccagatgttattcttcagattggaagcagaataacaagcaaacgtgtt
tcacaaatgatacaagattcttctccatgtcaatatatattagtggataaccatcctaat
cgacatgatccctcacatgtaattacacataggattcaaggtcatatccgtcattttacc
aattgtgtgatgagatcttgcacaaccaaaatcaacacccaatggacaaatttcctgtgt
tcaataaacatgatggttgagtgggagatatcatttttaatacattcagagaacaatttg
agtgaaccatatgttgctcatgtgacttcagaagctattgaatttggatccacaatgttc
ataggaaatagcatgccaatacgcgatgcagatatgtatggaagtagtcatggaaagggt
agtcatggtaaaattaccaaattaccctcaggttttccattcacctggatacaagtggct
ggaaacagaggtgctagtggtatcgatggtttactcagtactgctattggttttgctgta
ggccacaacaaaaaagttgtttgtgtgattggagatgtttcctttttacatgatacaaat
ggattagcacttttgaaacagaggatttcaagaaaacagatgacaataattgtgatcaac
aaccatggaggtgcgatttttagtcttctacctattgcaaataaagctgaagaaaaaata
ctgagtcaatatttttacacatctcatgatgttggaattcacaacttatgcaatgcacat
ggtgtgaagcatgtacatgtcagcacaaaatctgagctccaaaaggctctgttaaattct
caacatgaagaaagtgattgtgttattgaagttgagagctccattgatgccaataaaaac
tttcacagtaatttaagacaattttcatgtcaagcagcagggaattctttatccattatt
tcaaagctatcagttctcaattcaattaaagttcataaactggagttttttcaatacaga
attcaactctgtgctccattgacaactcctgttgttaatgacaattatagagaaggattt
gtgttaactttgtatcttgaagatggaagtactggaattggagaggtggcaccacttggg
acccacaagggaactcttcaagatgcacaagagcaacttcagtttcttacacatgttata
aaaggatccactttacattcatctcttcctcttctaaatggatccttctcttcatggata
tggaccaatttaggaatcccaccagattctattcttccaagtgttagatgtggtttggaa
atggcgattcttaatgctatagcttcagtacaaggttgttcttccagtatgttaaatatc
cttcacccttcagcacccaaacaagaaagtcctcaaaagtcatcaaatattacaatttgt
gcccttcttgactctaatggaactccttctgaagttgcttatcttgcatccaaacttgtt
gaagaaggtttcactacaatcaaactaaaagtggcacgtagggcccatcctattgaagat
gctcaagtcatacaagaaataaggaagaaaatcggtttccatattcaacttcgtgttgat
gcaaataaaaaatggtcttttaatgatgctcttcaatttggttctaatgtgaaggaatgt
gaacttcaatatattgaggagcctgtaaatgatgaagatgatataattaaattttgtgaa
gaaagcggaatacctgtagccctagatgaaaccattgacaatcttcaagaaaatcctctt
caagctctttcaagattcacacatgacaaaattgttgctgttgtaattaaaccaagcttt
gttggtggatttgagaaggctgcatacattgcaaggtgggcccaccatcatggaaaatta
gctgttgtcagtgctgcattcgaaagtggaatatctttgtcagcttacgttcaattttct
tgttttcttgaaatgaaaaataaagatatttgcaaaataatgaataaggaaattgtatct
gacgtggcacatggtcttggaacatacaagtggctcaaagatgatgtcatcatcaccgag
tcattgtgttttacgaaaagtcaagcttctgtttttgatgccggtcaaactttgaccaac
ttcaaaatcaatcggaattcggtattccggagttttgagagtgagaaactatggaattat
acacaaaaggtggatgttgaggggatgacattttccatcaatgtgaaagagcttggagac
aaaagaaatgataatgttattgtatttcttcatggattccttgggagtagtgaagattgg
attcccatcatgaacgccatgtcagcatcttctagatgtatcgcaatcgacctccctggt
catggtgggtcaaagatggatgccattgatgacgtggcacaaggagttgagctttcaatg
caggtagttacagatatgctagagaaactggtccttgtgctaaccactaaaaaagtgaca
cttgtcggatactccatgggagcgaggatcactttatacatggctttgaaattcaaaaat
atgataaaaggagtagtgatgatatctggaagccctggattggatgacgtggcaaaaaga
aagtctagaagtgttaaagacgattctttagcatgtgcacttgtttcatatggtgttgaa
ttattcattgagacatggtattctggagagatgtgggaaagcttaagaagccatccacaa
tttgagcaaatagttgctgaccggtcaaaacatgatgacgtgtcaggtcttgtaaaaaca
ctctctggcctaagcaccggaagacaaccgtcattgtgggaagatctaaagcatgtgaaa
tctcctgttgtggttattgttggtgagagagatgagaaatttaagaagattggtgagagg
atgtgcgtgacacttggcaagagtagagtggttgaggttcctaattgtgggcatgctgtt
catatagagagcccactccttgtaatccgatcgataacagagtttctcactagacttgat
tcataa

DBGET integrated database retrieval system