KEGG   Lactuca sativa (garden lettuce): 111899157Help
Entry
111899157         CDS       T05352                                 

Definition
(RefSeq) G-type lectin S-receptor-like serine/threonine-protein kinase At4g03230
Organism
lsv  Lactuca sativa (garden lettuce)
Brite
Enzymes [BR:lsv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111899157
Protein kinases [BR:lsv01001]
 Serine/threonine kinases: TKL group
  IRAK family
   111899157
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr DUF3403 Pkinase_fungal APH Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 111899157
NCBI-ProteinID: XP_023750807
Position
Unknown
AA seq 222 aa AA seqDB search
MRFEIIMGIARGLNYLHHDSRLRVIHRDLKTSNILLDEDMNPKISDFGLAKIVKGKDMEA
MTNRVIGTFGYMSPEYALDGLFSVKSDVFSFGVVMLEIVSGTKNTGFYQSQRSLSLLGHA
WNLWREDKPFELMDKVLIESCNSSEVLKCINIGLLCVQGDPDDRPTMTKVVLMLGGDIVT
LPTPKEPAFIARKDNATSSSSSSYKTDTQSKNMLTITKLDGR
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgagatttgaaatcattatgggaattgctagaggacttaactatcttcaccatgattct
aggttaagggttattcacagagatttgaaaacaagtaacattttgttagatgaggatatg
aatccaaaaatttcggattttggcttggccaagatagttaaaggtaaagatatggaagct
atgaccaacagagttatcggaacctttggctatatgtctccagagtacgcactagatggg
ctgttctcagttaaatcggatgtttttagctttggagtagtgatgcttgagattgtaagt
ggaacaaaaaatacaggattctatcaatcacagagaagtctaagtcttttaggacatgca
tggaatttatggagagaagataagccatttgagttgatggataaagtactaatagaatca
tgcaattcgagtgaggtattgaaatgtataaatattggactcctatgtgtacaaggagac
cctgatgatcgtcctaccatgaccaaagttgttttgatgcttggaggtgatattgtcaca
ctcccaactccaaaagaaccagccttcattgcaagaaaggacaatgctacttcctcttcc
tctagttcttataaaacagatacgcaatccaaaaatatgttgacaatcactaagttggat
ggacgctga

DBGET integrated database retrieval system