KEGG   Lactuca sativa (garden lettuce): 111899678Help
Entry
111899678         CDS       T05352                                 

Definition
(RefSeq) pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH10
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
lsv  Lactuca sativa (garden lettuce)
Pathway
lsv03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:lsv00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    111899678
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:lsv03041]
    111899678
Enzymes [BR:lsv01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     111899678
Spliceosome [BR:lsv03041]
 Complex C
  Other components
   Step II factors
    111899678
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C DEAD AAA_22 AAA_30 AAA_19 DUF2532 T2SSE DUF2075 ABC_tran
Motif
Other DBs
NCBI-GeneID: 111899678
NCBI-ProteinID: XP_023751303
Position
Unknown
AA seq 726 aa AA seqDB search
MPSMATGDRRNFNPNSNGTNNHPQFVPKLLNGDQKSDSFARRQKIEQQRRSLPIASVEKR
LVEEVRKNDTLIIVGETGSGKTTQLPQYLFNGGFCRDGGTIGITQPRRVAAVTVAKRVAE
ECGVELGQKVGYSIRFEDMTSTSTRIKYMTDGLLLREALLDPYLSRYSVIVVDEAHERTV
QTDVLLGLLKDVQKKRSQKTFSESNNNGTLVKEENNGEGEGSSVSVVKPQLVRKLNPLKL
IIMSASLDARGFSEYFGGAKAVHVQGRQFPVDILYTTQPETDCLDAALVTIFQIHLEEGP
GDILVFLSGQEEIESIEGLVRENLKKLPEANQKVLILPLFSSLPSEKQMKVFAPAPVGFR
KVILATNIAETSVTIPGIKYVIDPGLVKVRSYSPDSGIESLIVVKTSKAQALQRSGRAGR
EGAGKCFRLYPESRFEGLDDSTIPEIKRCNLSNVILQLSALGVDDILGFDFMEKPDRMAV
IRSLELLYLLGALTDEKKLSDPIGHQMARLPLEPNDSKALILASQFDCLEEMLIVVAMLS
VESIFYAPRDKLEESRTVIKSFSSPEGDHITLLNVYRASLEFLEKNKMENSKEKAEKNLR
KWCKDNFVNSRSLKHARDIYNQIRENVERMGLKISSCGDDMVPLRRCLAASYFLNAALKQ
PDGTYRVLANGQIAEIHPTSVLRRAKSECIIFYNLVQTTRNYVRNVTRIDYLWLAELAPQ
CYALKD
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgccttccatggctaccggagacagaagaaacttcaatcccaacagcaatggcaccaac
aatcatcctcaattcgtacctaaactccttaacggcgatcagaaatccgactcttttgcc
aggagacagaagattgagcaacagagaagatctttgcctattgcttcagttgagaaaaga
cttgttgaagaagtcaggaaaaatgataccttgataattgttggtgaaaccggaagcggg
aagaccacacagttgccccagtacttgttcaatggagggttttgtcgcgatggaggaaca
attggaatcactcaaccaagacgtgttgctgcagtaactgttgcaaaacgtgtagctgaa
gaatgtggtgttgagttgggccaaaaagttgggtactccattaggtttgaagacatgacc
tctacctcgacaagaatcaaatacatgacagatggattgctattaagggaagcacttttg
gacccctatctctcaagatactcagttatagttgttgatgaagctcatgagagaacagtc
cagacagatgtgcttttaggcttgctgaaagatgtacaaaagaagagatctcaaaaaact
tttagtgaatctaataacaatggaacactggtgaaggaagaaaataatggtgaaggtgaa
ggtagcagtgttagtgttgtgaagccacaattagtaagaaagttaaatccattaaagtta
atcatcatgtctgctagtttggatgcacgagggttttcagagtattttggtggtgcaaaa
gctgttcatgttcaggggcggcagtttccagtggatattctgtacaccacccaacctgag
acagattgtttggatgcagctttggttacaatatttcagatacatttggaggaggggccc
ggtgatatacttgtatttttgtctggtcaagaagagattgagtctattgagggtcttgtg
cgtgagaatcttaagaaactacctgaagccaatcagaaagtcttaatcttgccattgttc
tcttctcttccatcagagaagcaaatgaaggtttttgctcctgctcctgttggattcaga
aaggtaatactggcaactaacattgctgaaacatctgtgacaatacctggaattaaatat
gttattgatcctggattggtgaaagtgaggagttactctcctgatagtggcattgagtct
ctaattgttgttaaaacttcaaaagctcaagctcttcaaagaagtgggcgtgcagggcgt
gaaggagctgggaaatgctttcgtctttatccagagagcagatttgagggacttgatgat
tccacaataccagagatcaaaagatgcaacctttctaatgttattttgcagcttagtgct
cttggtgttgatgatatacttgggtttgacttcatggagaaaccagataggatggctgtg
attagatcactggagttattatacttgctaggtgctttaacagatgaaaagaaattatca
gatccaattggacaccaaatggcacgtcttccattagaaccaaatgattcaaaggctctt
attctagcttctcagtttgattgtttggaagaaatgttgatagttgttgcaatgctatca
gttgaatccatcttttatgctcctcgtgacaagttagaagagtcgcgaacagttattaaa
tcattctcgagccctgagggagaccatattactttacttaatgtttatcgtgcgtctctt
gagtttttagagaagaacaaaatggagaatagtaaagaaaaagctgaaaagaatctgagg
aaatggtgcaaggataactttgttaatagtcgttccttaaagcatgctcgtgacatttac
aatcaaatccgggaaaatgtagaacggatggggcttaagataagttcatgtggagatgac
atggttccacttcgtagatgtcttgctgcttcttatttcctgaatgcagccctgaagcaa
cctgatggaacctacagggttttggcaaatggtcagattgcggagattcacccgacttct
gttctacgacgtgcaaaatcagagtgcataatattttacaatcttgttcaaacaacgcgt
aattatgtgcgcaatgttactagaattgattatttgtggttggcagaacttgcccctcaa
tgttacgccttgaaggactag

DBGET integrated database retrieval system