KEGG   Lactuca sativa (garden lettuce): 111900476Help
Entry
111900476         CDS       T05352                                 

Definition
(RefSeq) alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
  KO
K00736  alpha-1,6-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase [EC:2.4.1.143]
Organism
lsv  Lactuca sativa (garden lettuce)
Pathway
lsv00510  N-Glycan biosynthesis
lsv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lsv00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    111900476
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:lsv01003]
    111900476
Enzymes [BR:lsv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.143  alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
     111900476
Glycosyltransferases [BR:lsv01003]
 Glycan extension
  N-Glycan
   111900476
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MGAT2
Motif
Other DBs
NCBI-GeneID: 111900476
NCBI-ProteinID: XP_023752127
Position
Unknown
AA seq 440 aa AA seqDB search
MSRNYIDRAMASYKKPRIRDGAVRRFLFVISLTITGVLLLFFLVAMNYSNSGLYQENTVE
IDVTSGVIFNISGSIESIKLPKHNYLSKMLEKKNQLPPRNIDLYPNLAKDRIIIVLYVHN
RPQYLKLVVDSLSHVSGINETLLIVSHDGYFEEMNKIIEGIKFCQVKQVFAPFSPHIFPN
YFPGVSPNDCKEKDDPIAKNCEGTTDQYGNHRSPKIVSLKHHWWWMMNTIWDGLQETINH
SGDILFIEEDHFIFPNAYRNLKMLTDLKSSKCPDCYAANLAPSNVKSRGEGWDTLIAERM
GNIGYTFNRTVWRKIHRKAKEFCLFDDYNWDITMWVTVYPSFGGPVYSMRGPRASAVHFG
KCGLHQGQGEQAACVDNGVVNIEVEEIDKVVNVKQEWGVHVFGNQEGYQAGFRGWGGWGD
KRDHQLCFDFAKMYHLRIKK
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgtctagaaattatatcgatagagccatggcttcttacaagaaaccccgtataagagat
ggagctgttcgtcgcttcctttttgtaatatccttaactataaccggggttcttttgcta
ttcttcctcgttgcaatgaattattcaaatagtgggttatatcaagaaaacactgttgaa
atcgatgttactagtggagtaatctttaacatctctggttcgatcgagtcgatcaagctt
cccaaacataattatttatcaaaaatgttggagaagaagaaccagttacccccaagaaac
atcgatttgtatccaaatctagccaaagatcgtatcataatcgttctctacgttcacaat
cgtccccaatatctaaaattagttgtcgacagcctttctcatgtgtcaggcatcaatgaa
actttattaatcgtaagccacgatggatacttcgaagaaatgaacaagattatcgaaggt
atcaaattttgtcaagtcaaacaagtcttcgctcctttttcacctcatattttccccaat
tatttccctggtgtatcccctaatgattgcaaagaaaaagacgaccctatagccaaaaac
tgtgaaggaactactgatcaatacgggaatcacaggtcaccaaagattgtgtctttaaaa
caccattggtggtggatgatgaacaccatatgggatggtcttcaagagacaatcaatcat
tcgggtgatattcttttcatagaagaagatcatttcattttcccaaatgcttatagaaat
ttgaagatgcttacagatttgaaatcctcaaaatgtcccgattgttatgcggcgaatctt
gctccaagtaatgtgaagtcaagaggtgaagggtgggatactttgatagcagaaagaatg
gggaacattgggtacacatttaatcgaacagtttggaggaaaatacatagaaaagccaaa
gagttttgtctttttgatgattataattgggatataacaatgtgggtgactgtttatcct
tcttttggtggtccggtttactctatgcgtgggccccgggcgagtgcggttcattttggg
aaatgtgggttgcatcaaggtcaaggagaacaagctgcttgtgttgataatggtgtggtg
aatattgaggttgaagagattgataaggtggtgaatgttaaacaagagtggggtgttcat
gtttttggtaatcaagaagggtatcaagctggatttagagggtggggtgggtggggggat
aaaagagatcatcaattgtgttttgattttgctaaaatgtatcatttgaggatcaaaaag
tag

DBGET integrated database retrieval system