KEGG   Lactuca sativa (garden lettuce): 111901418Help
Entry
111901418         CDS       T05352                                 

Definition
(RefSeq) probable nucleolar protein 5-2
  KO
K14565  nucleolar protein 58
Organism
lsv  Lactuca sativa (garden lettuce)
Pathway
lsv03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:lsv00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    111901418
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:lsv03009]
    111901418
Ribosome biogenesis [BR:lsv03009]
 Eukaryotic type
  Sno RNPs
   Box C/D snoRNPs
    111901418
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nop NOP5NT
Motif
Other DBs
NCBI-GeneID: 111901418
NCBI-ProteinID: XP_023753033
Position
Unknown
AA seq 573 aa AA seqDB search
MLVLFETPAGFALFKVLDEGKLSKVDDLWKDFSSADAARQVVKLKAFSKFENTSEALSAA
TLLIDSKPSKGLRKFLRSHCDGETLAVADSKLGNAIKEKLQIECVHNHTVMELMRGVRSQ
LTELITGLGAQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR
VREWYGWHFPELAKIVQDNILYAKAVKLMGYRTNAAKLDFSGILQEEVETELKEAAVVSM
GTEVSDLDLVNIKDLCDQVLSLSEYRAQLYDYLKSRMNTIAPNLTAIVGELVGARLIAHG
GSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLIYHASLIGQAAPKHKGKISRSL
AAKTALAIRYDALGDSQDNSMGMENRLKLEARLRSLEGRELGKSAGSTKGKPKIEVYNKD
LKKGDGAMITPAKTYNVAADSVLGRMEAEAEEDEEMVAAIDEGKKDKKKKKKKEEGVEDE
VEGSDGKKDKKKKKKKGGDDADEVVVVVNEEDGDKKKDKKKKKKKDGDDEVEKEEENVEV
EGKKKKKRKHGETEGETEKGSKKKDKKKKKVEE
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgttagtgctttttgaaacccccgcgggttttgccctttttaaagtattggatgaagga
aagctctccaaagttgatgatctgtggaaggacttctcatctgcagacgcagccagacag
gtggtaaagctaaaagccttttcgaagtttgagaacacatcagaagcactctcagcagct
accctgttaattgacagcaaacccagcaaaggtctgcgcaagttcttgcgttctcattgt
gatggcgagacattggctgttgcagactccaaacttggaaacgccatcaaagaaaaacta
caaatcgaatgtgttcacaaccacactgtcatggaacttatgagaggagtcagaagtcaa
ttgacagaacttataaccggtttaggcgcacaagatttagccccaatgagcttgggttta
tctcacagtttgtctagatacaaacttaagttcagcccagacaaagtggacaccatgatc
attcaagctattggcttgttagatgatcttgataaagagctcaacacctatgcaatgagg
gtgcgtgaatggtatggatggcattttccagaacttgctaaaatcgtacaagacaatatc
ttatatgccaaggcagtcaaactcatgggttatcgcacaaatgctgcaaaacttgatttc
tctgggatactacaagaagaggtggagacagaactaaaagaggcagctgtggtttccatg
ggaactgaagtgagtgaccttgacttggtcaacatcaaggacttatgtgaccaagtgttg
tctctttcagaatacagagctcaactttatgattatttgaagagcaggatgaatacaatt
gcccctaatttaactgccattgttggagagcttgttggagctcgattgattgctcatggt
ggtagtttgttgaatcttgcaaaacagcctggaagtacagttcagattcttggagctgaa
aaggctctttttagggctttgaagacaaaacatgcaacacctaaatatggtcttatttat
catgcaagtttaataggtcaagctgcaccaaaacataagggaaagatttcacgttctctt
gctgctaaaacagctttagcaattcgatatgatgctcttggagatagtcaagataattct
atgggaatggagaatcgtctcaagcttgaagctagattgagaagtcttgaagggcgagaa
cttgggaagtctgctggatcaactaaagggaagcctaagattgaggtttataataaggat
ctcaagaaaggagatggagctatgatcactcctgcaaagacttataatgtggcagcagat
tctgttcttgggaggatggaagcagaggctgaggaagatgaagagatggtggcagccatt
gatgagggaaagaaagataaaaagaagaagaaaaagaaggaggagggtgttgaagatgaa
gtggagggcagtgatggaaagaaagacaaaaagaagaagaaaaagaagggtggtgatgat
gctgatgaagtggtggtggtggtgaatgaggaagatggtgataaaaagaaagataaaaag
aaaaagaaaaagaaagatggtgatgatgaagtggagaaggaagaggagaatgttgaggtt
gaagggaagaagaaaaagaagagaaaacatggtgaaactgaaggagaaactgaaaaggga
agtaagaagaaagataagaaaaagaagaaggtagaagagtag

DBGET integrated database retrieval system