KEGG   Lactuca sativa (garden lettuce): 111903064Help
Entry
111903064         CDS       T05352                                 

Definition
(RefSeq) serine/threonine-protein kinase RIPK-like
Organism
lsv  Lactuca sativa (garden lettuce)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Crust_neurohorm
Motif
Other DBs
NCBI-GeneID: 111903064
NCBI-ProteinID: XP_023754626
Position
Unknown
AA seq 201 aa AA seqDB search
MKSANILLDDNMDTKICDFGLSRLDSTNQSDTGVVTKVAGTRFYMDPVCNKKSRLIKESD
IYSFGVVMFEMSSGMMAYIPSRIEDSKEQYLIDIVRSYYDDHKFVDKLIDSAIKGQIDMS
SFDKFNKIAHECISLDISLQMWIMFVKIRDLEIQLVNEASIFWILKVVWWMMKPFPGQCQ
TLIASQRSQGGGVRFSRDKHF
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaagagtgcaaatattttgttagatgataatatggacaccaaaatatgtgattttggt
ttgtcaagattagattcaacaaatcagtcagatactggtgtcgttacaaaggttgctggt
acaaggttttacatggatcctgtttgcaacaaaaaaagtaggctcattaaagagtccgac
atatattcatttggagtggtaatgtttgaaatgtctagtgggatgatggcttatattcca
agtcgcattgaagattctaaggaacaatatctgattgacatcgttcgaagctactatgac
gaccataaatttgttgacaagttaatagattcagctatcaaagggcagattgatatgagt
tcttttgataaatttaataaaattgcacatgagtgcattagcttggacatttcgttacag
atgtggataatgttcgttaaaatcagagatcttgaaattcagttggtcaatgaagcttcc
attttctggatattgaaggtggtgtggtggatgatgaagccttttcctggtcaatgccaa
actttgattgcttctcaaagatcacaaggaggtggtgtaagatttagccgtgacaaacat
ttctag

DBGET integrated database retrieval system