KEGG   Lactuca sativa (garden lettuce): 111903977Help
Entry
111903977         CDS       T05352                                 

Definition
(RefSeq) lactosylceramide 4-alpha-galactosyltransferase-like
  KO
K01988  lactosylceramide 4-alpha-galactosyltransferase [EC:2.4.1.228]
Organism
lsv  Lactuca sativa (garden lettuce)
Pathway
lsv00601  Glycosphingolipid biosynthesis - lacto and neolacto series
lsv00603  Glycosphingolipid biosynthesis - globo and isoglobo series
lsv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lsv00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    111903977
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    111903977
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:lsv01003]
    111903977
Enzymes [BR:lsv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.228  lactosylceramide 4-alpha-galactosyltransferase
     111903977
Glycosyltransferases [BR:lsv01003]
 Glycan extension
  P blood group
   111903977
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gb3_synth Gly_transf_sug Caps_synth TcdA_TcdB
Motif
Other DBs
NCBI-GeneID: 111903977
NCBI-ProteinID: XP_023755520
Position
Unknown
AA seq 466 aa AA seqDB search
MENKKRSFVAVLSLLLLLLIAFNGASIFSIMIPYPENIAGDSRNLVSVSSSLSNLMYALE
EENPSVISKTHFKLQRNTVAGAGDYTSFNPVPYSMHDVEQHQQQSISLVKEETPSVISNT
HLPLLRKSHSLPFESEDFPVKKKKLLEGLTFLEPSDRLRRGYFRARVKEFFSKNETSCKV
RFFMTWISPLNSFGEKEVHSIETVFNTHPTGCLLILSNSMDSNRGRQILKPFLEKGFRVT
AISPDLHYLFKNTMAESWFFKLTRGDVDAGFIPFGQNLSNLLRLCLLYKFGGVYMDTDVM
ILKSFSKLKNSIGAQTLDLGSKNWSRLNNAVMVFDKMHPLVYKFIEEFALTFNGNKWGHN
GPYLVSRVVSRLEGRPGYNFTILPPSAFYPVNWNRVRNLFRGAKNETDAKWLRCKLRQIR
SQSYAVHLWNKQSRNLRVEEGSIVGKILSSHCVFCNSSTNSIVSIQ
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggagaataagaagagatctttcgttgctgttttatctcttctcttgcttctgttaatt
gctttcaatggagcttctatcttctccataatgataccttacccggaaaatatcgccgga
gattcaagaaacttggtgtctgtgtcgtcttctttgtcgaatttgatgtatgcgcttgaa
gaagaaaacccatctgtaatctcgaaaacccatttcaagttacagcgaaatacggtggcc
ggcgccggagattatacgagctttaaccctgtaccttactcaatgcacgatgtagaacaa
catcagcagcagagtatatccttggtgaaagaagaaaccccatctgtaatctcaaatacc
catttaccccttctgcgaaaatctcacagtttacctttcgaatccgaagatttcccggtc
aaaaagaagaaacttttggagggtttgactttcttggagccttctgaccggctccggcga
gggtatttccgggcgagagtgaaggaattctttagcaagaatgagacttcttgcaaggtt
cgtttctttatgacgtggatttcgccattgaattcttttggtgaaaaagaagtccactca
atcgaaactgtattcaacacacacccaactgggtgtctgctaatcctttcaaactccatg
gattcgaatagaggacgccagattctaaaaccatttttggaaaaagggtttcgagtaaca
gcaatttcgcctgatttacactacttgttcaagaacacaatggcagaatcatggtttttt
aagttaactagaggtgatgttgatgctgggttcattccatttggtcaaaacttatcgaac
ttgcttcggctttgtttgttatataaattcggtggggtttatatggataccgatgttatg
attttgaaaagcttctcgaagttaaagaattcaatcggagctcaaacattggatttgggt
tcaaagaactggagcaggttgaataatgcagtcatggtgttcgataaaatgcatccattg
gtttacaagtttatcgaagagttcgcattaactttcaatggaaacaaatggggtcacaat
ggtccttacttggtttcacgtgtagtttcaaggcttgaaggtaggcctggatataatttt
acgattctacccccatcagctttttatccagtgaactggaacagggttcggaatcttttt
cgtggggctaaaaatgagacggatgcaaaatggttgaggtgtaaacttaggcagattcga
agccagagttatgctgttcatctttggaataagcagagtagaaaccttcgtgttgaagaa
ggaagcattgtgggaaagattttatcaagtcattgtgttttctgcaattcatccacaaat
agcattgtaagtatacaataa

DBGET integrated database retrieval system