KEGG   Lactuca sativa (garden lettuce): 111906167
Entry
111906167         CDS       T05352                                 

Definition
(RefSeq) cytochrome P450 71AV8
  KO
K15800  germacrene A oxidase [EC:1.14.14.95]
Organism
lsv  Lactuca sativa (garden lettuce)
Pathway
lsv00909  Sesquiterpenoid and triterpenoid biosynthesis
lsv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lsv00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    111906167
Enzymes [BR:lsv01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.95  germacrene A hydroxylase
     111906167
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 111906167
NCBI-ProteinID: XP_023757663
Position
Unknown
AA seq 497 aa
METSVITTLGLAAIIFILFKLVTRPKSKKNLLPEPWRLPIIGHMHHLIGTMPHRGVMELA
RKHGSLMHLQLGEVSTIVVSSPRWAKEVLTTYDITFANRPETLTGEIVAYHNTDIVLAPY
GEYWRQLRKLCTLELLSNKKVKSFQSLREEECWNLVKHIRSTGQGSPINLSENIFKMIAT
ILSRAAFGKGIKDQMKFTELVKEILRLTGGFDVADIFPSKTLLHHLSGKRAKLTNIHNKL
DNLINNIMAEHPGNRTSSSQETLLDVLLRLKESAEFPLTADNVKAVILDMFGAGTDTSSA
TIEWAISELIRCPRAMEKVQAELRQALNGKERIQEEDIQELNYLKLVIKETLRLHPPLPL
VMPRECREPCVLGGYDIPSKTKLIVNVFAINRDPEYWKDAETFMPERFENSSITVMGSEY
EYLPFGAGRRMCPGAALGLANVELPLAHILYYFNWKLPNGKTFQDLDMTESFGATVQRKT
ELLLVPTDFKTLEASSY
NT seq 1494 nt   +upstreamnt  +downstreamnt
atggagacttcggtcatcactacccttggccttgccgctatcatcttcatcctcttcaag
ctagtaacacgtcccaaatcaaagaaaaatctgctcccagagccatggagactaccaata
atcggacacatgcaccatttgataggtacgatgccacatcgtggtgtcatggagttagca
aggaaacatggatctctcatgcatctacaacttggagaggtgtccacgatcgttgtttca
tccccacgttgggcaaaagaggttctgacaacgtatgatattactttcgcaaacagaccg
gagactttaaccggtgagattgttgcatatcacaataccgatattgtccttgctccctat
ggtgaatactggaggcagttgcgaaagctttgcaccttggagcttttgagtaacaagaaa
gtgaagtcctttcaatcccttcgtgaggaggagtgttggaatttggttaagcatattcga
tcaactgggcagggatcaccaatcaatctttcagaaaacattttcaagatgattgctacc
atacttagtagggcggcgtttggaaaaggaatcaaagaccaaatgaaatttaccgaatta
gtaaaagaaatactaaggttgactggaggttttgatgtggcggatatctttccttctaaa
acgttgcttcaccacctttcagggaagagagctaagttaaccaacatacacaataagctt
gacaatttgatcaacaatatcatggccgagcaccctggaaatcgtacaagctcatcacaa
gagactctacttgatgttctgttaagactgaaagaaagcgctgagtttccattgacagca
gacaacgtcaaagcagtcatcttggatatgtttggagctggcacagatacatcatcagcc
acaattgaatgggcaatctctgaattgataaggtgtccaagagcgatggagaaagtacaa
gcagaactaaggcaagcactaaatggaaaggaaaggatccaagaggaagatatacaagaa
ctaaactacctaaagctagtgatcaaagaaacattgaggttgcacccaccactaccgttg
gttatgcctagagagtgtagggagccatgtgtgttggggggatacgacataccaagcaag
acaaaacttattgtcaatgtgtttgccataaacagggatcctgaatactggaaagatgct
gaaactttcatgccagagagattcgaaaacagctccatcactgtaatgggttcagagtat
gagtatctcccgtttggtgctggaaggagaatgtgtcctggagctgcccttggtttagcc
aacgtggaacttcctttggctcatatactttactacttcaactggaagctcccaaatggc
aaaacttttcaagacttggatatgactgagagctttggagccactgttcaaagaaagacc
gagttgttactagtgcctacagatttcaaaacacttgaagcgtcaagttattga

DBGET integrated database retrieval system