KEGG   Lactuca sativa (garden lettuce): 111906272Help
Entry
111906272         CDS       T05352                                 

Definition
(RefSeq) probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH4 isoform X1
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
lsv  Lactuca sativa (garden lettuce)
Pathway
lsv03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:lsv00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    111906272
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:lsv03041]
    111906272
Enzymes [BR:lsv01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     111906272
Spliceosome [BR:lsv03041]
 Complex C
  Other components
   Step II factors
    111906272
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C DEAD AAA_22 AAA_30 DUF2075 AAA_19 ABC_tran T2SSE AAA_16 Helicase_RecD AAA_33 SRP54 AAA_29 Flavi_DEAD DAP3 AAA_14 ATPase_2 AAA_23 NB-ARC MMR_HSR1
Motif
Other DBs
NCBI-GeneID: 111906272
NCBI-ProteinID: XP_023757801
Position
Unknown
AA seq 701 aa AA seqDB search
MANLPILQFEDKILETVDHNPVVVVIGETGSGKSTQLSQILHRSGYTKAGTIAVTQPRRV
AAVSVSRRVAQELGVRLGDEVGYAIRFEDRTSERTCIKYLTDGVLLRESLSDPELKQYSV
VILDEAHERSLNTDILMGLMKRLIRLRASNLKVLITSATLDGEKVSRFFSDCPVLNVPGK
LFPVEILYSAEQPKSYIESSLKKAIDIHVNEPEGDILIFMTGQDDIEKLVSKLEERIQSL
EVGSCMDAIVLPLHGSLPPEMQVRVFNPPPPNCRRFIVATNIAETSLTVDGVVYVIDSGY
VKQRQYNPSSGMYSLDVVQISRVQANQRAGRAGRTRPGKCFRLYPLAVYQDNLLEATVPE
IQRSSLAGSVLYLKSLDLPDIDILKFDFLDAPSHESLQDALKQLFLIDALDENGTITPIG
KTMSELPLEPSLARTLIEANEYGCLSQALSVAAMLSVEGTLLPGRSKNTDRKRKHPPSDL
PDGSGLGDHIQLLQIYELWDEVDYSIDWCKDNNLQVRGMLFAKDVRKQLSQIMQKVAKGG
LDIKRKERRRDREENYKNLRKALCVGYASQLAERMIRHNGYRTLGFKSQLVQVHPSSVLR
TDEEGMLPNYVVYHELISTTRPYMRNLCEVEMQWVTPILQKLEKLNVNKLSGGSNQAEEA
STTDDLGGPQREREKEVKNGDDSNARIQAARDRFLARKGNK
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacctcccaattctacaatttgaagacaagatattagaaaccgtggatcacaat
ccagtagtggtggtaattggtgagacgggttcagggaagagcactcaactctctcagatt
ttacacagaagcggctacacgaaggccggaaccatcgccgtcacccagccacgccgtgtc
gccgccgtatctgtttctagaagggttgcacaggagcttggtgtccgactgggtgatgaa
gttggttatgccataagattcgaggacagaacttcagagagaacttgtattaagtatctt
actgatggagtactcctccgtgaaagcctttctgaccctgagctcaaacaatattctgtt
gtcatattagatgaggctcatgaaaggagtctaaacacggatatattaatggggctgatg
aaaaggttgattagactgcgtgcttccaatttgaaagttttgatcacttcagctactctt
gatggtgaaaaggtgtcaagatttttctctgattgcccagtcctaaatgttcctgggaaa
ttgtttcctgtagaaatattatatagtgcagaacaacccaaaagttatatagaatcatct
ctgaaaaaagctattgacatacacgttaacgagccagaaggggacattttgatatttatg
actgggcaggatgacatagagaaattggtatcaaaactggaagaaagaattcaaagcctt
gaagtagggtcttgtatggatgccatagtcctgccacttcatggttcattgccacctgaa
atgcaggtgcgagtgtttaatcctccacctccaaactgtaggcgtttcattgttgcaaca
aacattgctgaaacttccttgactgttgatggcgttgtgtatgttatagactccggttat
gtgaagcagcgacagtataatccatcaagtggaatgtattctcttgatgttgttcagatt
agcagggtgcaggctaaccaacgggcgggtcgggcaggaagaacacgacccgggaagtgt
tttcggttatacccgttggctgtttaccaagacaatttattggaagccactgttcctgaa
atacaacgttcttctttagctggaagtgttctttatttaaaatctttggatcttccagat
attgatattcttaaatttgactttcttgatgcaccttcgcatgagtctttacaagatgct
cttaaacagttgtttctgattgatgctttagacgagaatgggactattacgcctatagga
aaaacaatgtcagagcttcctttggaaccttcacttgcaaggactttaattgaggcgaat
gaatatggttgtttatctcaagctttgagtgtagctgctatgttatcagtggaaggtact
ttgcttcctggacgaagcaaaaacacagacaggaagagaaagcatcctccttcagatctt
cctgatgggtctggtttgggtgatcacatccagttacttcagatctatgagctttgggat
gaagttgactatagtattgactggtgtaaagataacaacctacaggtacgtgggatgcta
tttgctaaagatgttcggaaacaattgtcgcaaataatgcagaaggttgcaaaaggaggc
ttagatataaaaagaaaggaaagaaggagagatagagaagaaaattataagaatctaaga
aaggctttgtgtgtggggtatgcaagccagctggcagagcggatgattcgtcataacggt
taccggactcttggcttcaagtctcaacttgtccaggtgcacccgtcttccgtgctgcga
acagatgaagaaggaatgcttccaaattatgttgtgtaccatgaacttatttctactaca
cgcccatacatgcgcaatctgtgtgaagtagagatgcaatgggtgaccccaatattgcaa
aagcttgagaagctaaatgtcaacaaactaagtggtggatcgaaccaggccgaggaggcg
agcacaaccgatgatttgggtggtccccagagagagagagagaaagaggtgaaaaatgga
gatgactccaacgctagaatacaagcagctcgggaccgctttctagcccggaaaggaaat
aaatag

DBGET integrated database retrieval system