KEGG   Lactuca sativa (garden lettuce): 111906615Help
Entry
111906615         CDS       T05352                                 

Definition
(RefSeq) uncharacterized protein LOC111906615
  KO
K17434  large subunit ribosomal protein L53
Organism
lsv  Lactuca sativa (garden lettuce)
Brite
KEGG Orthology (KO) [BR:lsv00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:lsv03011]
    111906615
Ribosome [BR:lsv03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    111906615
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MRP_L53 L51_S25_CI-B8
Motif
Other DBs
NCBI-GeneID: 111906615
NCBI-ProteinID: XP_023758149
Position
Unknown
AA seq 128 aa AA seqDB search
MLKFLSKVKIEFNALDPRTAACMEFLAQCNARTAKESNPSCQLLVKRRTDSHPPQISVTF
VNGVEEVFDATSTPAQTIRKMILEKGTQLETEQMFREAGEKWPVIIPEEELRQSFPGTKP
RKAEDKKQ
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgttgaagttcttatcaaaagtgaagatcgaattcaatgccctagacccacgcacggcg
gcatgtatggagtttttggctcagtgcaatgctcgaacagcgaaggaatcaaacccttcg
tgtcagctattggtgaagcgccgcactgacagccacccaccgcagatctccgtgacgttc
gtgaacggagtcgaggaggtttttgatgccacttccacacctgcgcagactatcaggaag
atgattctggaaaaaggcacgcagctggagactgagcaaatgtttcgtgaagccggcgag
aagtggcctgttattattccagaggaagagctccgtcaatcgttccccggtaccaagcca
aggaaagcagaagacaagaagcaatag

DBGET integrated database retrieval system